RetrogeneDB ID: | retro_ptro_277 | ||
Retrocopylocation | Organism: | Chimpanzee (Pan troglodytes) | |
Coordinates: | 1:22064979..22065306(-) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | MPHOSPH6 | ||
Ensembl ID: | ENSPTRG00000008398 | ||
Aliases: | None | ||
Description: | None |
Percent Identity: | 70.8 % |
Parental protein coverage: | 69.38 % |
Number of stop codons detected: | 2 |
Number of frameshifts detected | 2 |
Parental | MAAERKTKLSKNLLRMKFMQRGLDSETKKQLEEEEKKIISEEHWYLDLPELKE-KESFIIEEQSFLLCED |
MA.E.KTK.SKNLL.MKFMQR.LDSETKK.LEEEE.K.IS.EHWY.DLPEL......FI.EEQ..LLCED | |
Retrocopy | MAPEHKTKFSKNLLYMKFMQRRLDSETKK*LEEEENK-IS*EHWYSDLPELNK<VKNFITEEQHLLLCED |
Parental | LLYGR-MSFRGFNPEVEKLMLQMNAKHKAEEVEDETVELDVSD |
..YGR..SF..F.PEVEKL.LQMN.K.KA.E.EDETVE..VSD | |
Retrocopy | HFYGR>ISFIRFTPEVEKLVLQMNTKNKA-EIEDETVEFYVSD |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP007412_brain_prefrontal_cortex | 0 .14 RPM | 10 .28 RPM |
SRP007412_cerebellum | 0 .00 RPM | 8 .25 RPM |
SRP007412_heart | 0 .00 RPM | 3 .26 RPM |
SRP007412_kidney | 0 .03 RPM | 4 .18 RPM |
SRP007412_liver | 0 .00 RPM | 2 .03 RPM |
SRP007412_testis | 0 .00 RPM | 6 .53 RPM |
Species | RetrogeneDB ID |
---|---|
Homo sapiens | retro_hsap_353 |
Pongo abelii | retro_pabe_348 |
Macaca mulatta | retro_mmul_471 |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Choloepus hoffmanni | ENSCHOG00000000127 | 2 retrocopies | |
Callithrix jacchus | ENSCJAG00000016498 | 5 retrocopies | |
Dipodomys ordii | ENSDORG00000011060 | 2 retrocopies | |
Echinops telfairi | ENSETEG00000010276 | 6 retrocopies | |
Homo sapiens | ENSG00000135698 | 1 retrocopy | |
Gorilla gorilla | ENSGGOG00000001405 | 1 retrocopy | |
Macropus eugenii | ENSMEUG00000000580 | 1 retrocopy | |
Myotis lucifugus | ENSMLUG00000000268 | 1 retrocopy | |
Macaca mulatta | ENSMMUG00000022575 | 2 retrocopies | |
Mus musculus | ENSMUSG00000031843 | 2 retrocopies | |
Nomascus leucogenys | ENSNLEG00000010725 | 1 retrocopy | |
Oryctolagus cuniculus | ENSOCUG00000024341 | 2 retrocopies | |
Otolemur garnettii | ENSOGAG00000012532 | 3 retrocopies | |
Pongo abelii | ENSPPYG00000007592 | 1 retrocopy | |
Pan troglodytes | ENSPTRG00000008398 | 1 retrocopy |
retro_ptro_277 ,
|
Rattus norvegicus | ENSRNOG00000050087 | 6 retrocopies | |
Tupaia belangeri | ENSTBEG00000013110 | 8 retrocopies | |
Tarsius syrichta | ENSTSYG00000001928 | 2 retrocopies |