RetrogeneDB ID: | retro_itri_756 | ||
Retrocopy location | Organism: | Squirrel (Ictidomys tridecemlineatus) | |
| Coordinates: | JH393318.1:8540652..8540840(-) | ||
| Located in intron of: | ENSSTOG00000003121 | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | NDUFA3 | ||
| Ensembl ID: | ENSSTOG00000025377 | ||
| Aliases: | None | ||
| Description: | NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 3, 9kDa [Source:HGNC Symbol;Acc:7686] |
| Percent Identity: | 73.85 % |
| Parental protein coverage: | 77.11 % |
| Number of stop codons detected: | 1 |
| Number of frameshifts detected: | 1 |
| Parental | ELAAFLKNAWAKEPVLVVSFAIGSLAV-ILPPLSPYTKYAIMINKATPYNYPVPVRDDGNMPDVP |
| ..AAFL..AWA.E...VVSFAIGSL...ILPP.SPYTKYAIMINKA.PYNYPV...DDGN.PDVP | |
| Retrocopy | KFAAFLRKAWA*E-LVVVSFAIGSLSE<ILPPFSPYTKYAIMINKAIPYNYPVSLQDDGNVPDVP |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |