RetrogeneDB ID: | retro_ptro_1032 | ||
Retrocopy location | Organism: | Chimpanzee (Pan troglodytes) | |
| Coordinates: | 15:87743462..87743705(+) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | NDUFA3 | ||
| Ensembl ID: | ENSPTRG00000028890 | ||
| Aliases: | NDUFA3, CI-B9 | ||
| Description: | Pan troglodytes NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 3, 9kDa (NDUFA3), mRNA. [Source:RefSeq mRNA;Acc:NM_001251975] |
| Percent Identity: | 63.1 % |
| Parental protein coverage: | 100.0 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected: | 0 |
| Parental | MAARVGAFLKNAWDKEPVLVVSFVVGGLAVILPPLSPYFKYSVMINKATPYNYPVPVRDDGNMPDVPSHP |
| ..A...AFLKNAW.KE.VLV.....GGLA..L.P..PY..YS..IN.ATP.N.PVP.RDDGNM.D.PSHP | |
| Retrocopy | LVAIAAAFLKNAWPKERVLVLFLTIGGLAINLTPVCPYTMYSTRINQATPHNNPVPLRDDGNMLDMPSHP |
| Parental | QDPQGPSLEWLKKL |
| Q...GPS.EWLKKL | |
| Retrocopy | Q---GPSMEWLKKL |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP007412_brain_prefrontal_cortex | 0 .30 RPM | 64 .38 RPM |
| SRP007412_cerebellum | 0 .32 RPM | 15 .16 RPM |
| SRP007412_heart | 0 .03 RPM | 20 .64 RPM |
| SRP007412_kidney | 0 .00 RPM | 44 .88 RPM |
| SRP007412_liver | 0 .00 RPM | 21 .67 RPM |
| SRP007412_testis | 0 .00 RPM | 7 .48 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Bos taurus | ENSBTAG00000007754 | 2 retrocopies | |
| Canis familiaris | ENSCAFG00000002703 | 4 retrocopies | |
| Callithrix jacchus | ENSCJAG00000018518 | 5 retrocopies | |
| Cavia porcellus | ENSCPOG00000021937 | 1 retrocopy | |
| Equus caballus | ENSECAG00000015897 | 3 retrocopies | |
| Felis catus | ENSFCAG00000003611 | 6 retrocopies | |
| Gorilla gorilla | ENSGGOG00000023650 | 2 retrocopies | |
| Loxodonta africana | ENSLAFG00000018014 | 2 retrocopies | |
| Macropus eugenii | ENSMEUG00000002939 | 2 retrocopies | |
| Monodelphis domestica | ENSMODG00000004118 | 1 retrocopy | |
| Mustela putorius furo | ENSMPUG00000010317 | 3 retrocopies | |
| Mus musculus | ENSMUSG00000035674 | 3 retrocopies | |
| Otolemur garnettii | ENSOGAG00000006931 | 10 retrocopies | |
| Pan troglodytes | ENSPTRG00000028890 | 5 retrocopies | |
| Pteropus vampyrus | ENSPVAG00000015560 | 5 retrocopies | |
| Rattus norvegicus | ENSRNOG00000014224 | 1 retrocopy | |
| Sarcophilus harrisii | ENSSHAG00000009016 | 2 retrocopies | |
| Sus scrofa | ENSSSCG00000003261 | 3 retrocopies | |
| Ictidomys tridecemlineatus | ENSSTOG00000025377 | 2 retrocopies |