RetrogeneDB ID: | retro_mputfur_1070 | ||
Retrocopy location | Organism: | Ferret (Mustela putorius furo) | |
| Coordinates: | GL897006.1:4550753..4550992(+) | ||
| Located in intron of: | ENSMPUG00000015418 | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | None | ||
| Ensembl ID: | ENSMPUG00000010317 | ||
| Aliases: | None | ||
| Description: | None |
| Percent Identity: | 53.01 % |
| Parental protein coverage: | 95.24 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected: | 3 |
| Parental | PPGLATFLKDAWAKEPVLVASFTIGGLAIILPAFS-PFTKYAAMINQVT-PYNYPVPVRDDGNMPDVPSH |
| P.G..TFLK.AWAKEP........G..AI.L...S.P.TKY..MI.....P..YP.P...DGNMPD.PSH | |
| Retrocopy | PSGMDTFLKNAWAKEPGMIVFPLSGVPAITLSPLS<PYTKYTIMIHPTA>PSAYPAPLCHDGNMPDIPSH |
| Parental | PQ-DPQGPSLEWL |
| .Q.DP.GP.LE.L | |
| Retrocopy | TQ<DPHGPNLEKL |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |