RetrogeneDB ID: | retro_ptro_255 | ||
Retrocopylocation | Organism: | Chimpanzee (Pan troglodytes) | |
Coordinates: | 1:205132754..205133005(+) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | NDUFA3 | ||
Ensembl ID: | ENSPTRG00000028890 | ||
Aliases: | NDUFA3, CI-B9 | ||
Description: | Pan troglodytes NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 3, 9kDa (NDUFA3), mRNA. [Source:RefSeq mRNA;Acc:NM_001251975] |
Percent Identity: | 77.65 % |
Parental protein coverage: | 100. % |
Number of stop codons detected: | 0 |
Number of frameshifts detected | 1 |
Parental | MAARVGAFLKNAWDKEPVLVVSFVVGGLAVILPPLSPYFKYSVMINKATPYNYPVPVRDDGNM-PDVPSH |
M..R.GAFLKNAW.KEP.LVVSFV.G.L.VILPPLSPY.KYS.MIN.ATPYNYPVPV.DDGNM..D..SH | |
Retrocopy | MVVRLGAFLKNAWAKEPMLVVSFVIGSLTVILPPLSPYTKYSIMINEATPYNYPVPVHDDGNM<ADMCSH |
Parental | PQDPQGPSLEWLKKL |
PQ.PQ.PSLEWLKK. | |
Retrocopy | PQGPQSPSLEWLKKV |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP007412_brain_prefrontal_cortex | 0 .00 RPM | 64 .38 RPM |
SRP007412_cerebellum | 0 .00 RPM | 15 .16 RPM |
SRP007412_heart | 0 .00 RPM | 20 .64 RPM |
SRP007412_kidney | 0 .00 RPM | 44 .88 RPM |
SRP007412_liver | 0 .00 RPM | 21 .67 RPM |
SRP007412_testis | 0 .00 RPM | 7 .48 RPM |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Bos taurus | ENSBTAG00000007754 | 2 retrocopies | |
Canis familiaris | ENSCAFG00000002703 | 4 retrocopies | |
Callithrix jacchus | ENSCJAG00000018518 | 5 retrocopies | |
Cavia porcellus | ENSCPOG00000021937 | 1 retrocopy | |
Equus caballus | ENSECAG00000015897 | 3 retrocopies | |
Felis catus | ENSFCAG00000003611 | 6 retrocopies | |
Gorilla gorilla | ENSGGOG00000023650 | 2 retrocopies | |
Loxodonta africana | ENSLAFG00000018014 | 2 retrocopies | |
Macropus eugenii | ENSMEUG00000002939 | 2 retrocopies | |
Monodelphis domestica | ENSMODG00000004118 | 1 retrocopy | |
Mustela putorius furo | ENSMPUG00000010317 | 3 retrocopies | |
Mus musculus | ENSMUSG00000035674 | 3 retrocopies | |
Otolemur garnettii | ENSOGAG00000006931 | 10 retrocopies | |
Pan troglodytes | ENSPTRG00000028890 | 5 retrocopies | |
Pteropus vampyrus | ENSPVAG00000015560 | 5 retrocopies | |
Rattus norvegicus | ENSRNOG00000014224 | 1 retrocopy | |
Sarcophilus harrisii | ENSSHAG00000009016 | 2 retrocopies | |
Sus scrofa | ENSSSCG00000003261 | 3 retrocopies | |
Ictidomys tridecemlineatus | ENSSTOG00000025377 | 2 retrocopies |