RetrogeneDB ID: | retro_mdom_387 | ||
Retrocopy location | Organism: | Opossum (Monodelphis domestica) | |
| Coordinates: | 1:357768844..357769213(+) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | None | ||
| Ensembl ID: | ENSMODG00000010850 | ||
| Aliases: | None | ||
| Description: | None |
| Percent Identity: | 99.19 % |
| Parental protein coverage: | 50.2 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected: | 0 |
| Parental | FCRKCFLTAMRESGIHCPLCRGNVTRRERACPERALDIENVMRKFSGSCRCCAKQIKFYRMRHHYKSCKK |
| FCRKCFLTAMRESGIHCPLCRGNVTRRERACPE.ALDIENVMRKFSGSCRCCAKQIKFYRMRHHYKSCKK | |
| Retrocopy | FCRKCFLTAMRESGIHCPLCRGNVTRRERACPEWALDIENVMRKFSGSCRCCAKQIKFYRMRHHYKSCKK |
| Parental | YQDEYGVSSIIPNFQISQDSVGNSNRSETSTSDNTETYQGDASSTGHPTFKCP |
| YQDEYGVSSIIPNFQISQDSVGNSNRSETSTSDNTETYQGDASSTGHPTFKCP | |
| Retrocopy | YQDEYGVSSIIPNFQISQDSVGNSNRSETSTSDNTETYQGDASSTGHPTFKCP |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP007412_brain | 0 .00 RPM | 0 .00 RPM |
| SRP007412_cerebellum | 0 .33 RPM | 0 .00 RPM |
| SRP007412_heart | 0 .00 RPM | 0 .00 RPM |
| SRP007412_kidney | 0 .00 RPM | 0 .00 RPM |
| SRP007412_liver | 0 .00 RPM | 0 .00 RPM |
| SRP007412_testis | 0 .98 RPM | 0 .00 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Bos taurus | ENSBTAG00000020160 | 1 retrocopy | |
| Choloepus hoffmanni | ENSCHOG00000012689 | 6 retrocopies | |
| Callithrix jacchus | ENSCJAG00000020875 | 1 retrocopy | |
| Erinaceus europaeus | ENSEEUG00000009856 | 1 retrocopy | |
| Felis catus | ENSFCAG00000014180 | 2 retrocopies | |
| Homo sapiens | ENSG00000134758 | 1 retrocopy | |
| Gorilla gorilla | ENSGGOG00000027857 | 1 retrocopy | |
| Loxodonta africana | ENSLAFG00000003811 | 1 retrocopy | |
| Monodelphis domestica | ENSMODG00000010850 | 4 retrocopies | |
| Mustela putorius furo | ENSMPUG00000006982 | 1 retrocopy | |
| Mus musculus | ENSMUSG00000024317 | 2 retrocopies | |
| Nomascus leucogenys | ENSNLEG00000006401 | 1 retrocopy | |
| Ochotona princeps | ENSOPRG00000011494 | 1 retrocopy | |
| Pongo abelii | ENSPPYG00000009094 | 1 retrocopy | |
| Pan troglodytes | ENSPTRG00000009956 | 1 retrocopy | |
| Pteropus vampyrus | ENSPVAG00000003778 | 2 retrocopies | |
| Rattus norvegicus | ENSRNOG00000015645 | 3 retrocopies | |
| Ictidomys tridecemlineatus | ENSSTOG00000002293 | 2 retrocopies |