RetrogeneDB ID: | retro_mdom_746 | ||
Retrocopy location | Organism: | Opossum (Monodelphis domestica) | |
| Coordinates: | 2:306224766..306225014(+) | ||
| Located in intron of: | ENSMODG00000018777 | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | C6orf52 | ||
| Ensembl ID: | ENSMODG00000028324 | ||
| Aliases: | None | ||
| Description: | chromosome 6 open reading frame 52 [Source:HGNC Symbol;Acc:20881] |
| Percent Identity: | 70.24 % |
| Parental protein coverage: | 56.85 % |
| Number of stop codons detected: | 3 |
| Number of frameshifts detected: | 1 |
| Parental | VFYGNIQDVSSAKENTK-DLAEIPVMSEDWTTNNDEEQTEDPQIHLDIENLNKEFMVESEELYDSLMNCH |
| .FY.NIQ...SAKEN.K.DL.EIP.MSE.WTTNNDE.QT.D..IHLDIEN.NK.F.V..EELYDSLMNCH | |
| Retrocopy | IFYANIQNIFSAKENIK<DLIEIPAMSEAWTTNNDEWQTKDL*IHLDIENQNK*FRV*REELYDSLMNCH |
| Parental | WQPLDTVASWIPNN |
| W.P.D.VA..I.NN | |
| Retrocopy | WPPWDSVAYRIQNN |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP007412_brain | 0 .00 RPM | 0 .00 RPM |
| SRP007412_cerebellum | 0 .00 RPM | 0 .00 RPM |
| SRP007412_heart | 0 .00 RPM | 0 .00 RPM |
| SRP007412_kidney | 0 .00 RPM | 0 .00 RPM |
| SRP007412_liver | 0 .00 RPM | 0 .00 RPM |
| SRP007412_testis | 0 .00 RPM | 0 .00 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Ailuropoda melanoleuca | ENSAMEG00000002583 | 1 retrocopy | |
| Canis familiaris | ENSCAFG00000030234 | 1 retrocopy | |
| Choloepus hoffmanni | ENSCHOG00000010768 | 2 retrocopies | |
| Equus caballus | ENSECAG00000008229 | 2 retrocopies | |
| Monodelphis domestica | ENSMODG00000028324 | 12 retrocopies | |
| Tursiops truncatus | ENSTTRG00000003650 | 1 retrocopy | |
| Vicugna pacos | ENSVPAG00000003001 | 2 retrocopies |