RetrogeneDB ID: | retro_mdom_763 | ||
Retrocopy location | Organism: | Opossum (Monodelphis domestica) | |
| Coordinates: | 2:384194894..384195327(+) | ||
| Located in intron of: | ENSMODG00000017849 | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | ANP32B | ||
| Ensembl ID: | ENSMODG00000003261 | ||
| Aliases: | None | ||
| Description: | acidic (leucine-rich) nuclear phosphoprotein 32 family, member B [Source:HGNC Symbol;Acc:16677] |
| Percent Identity: | 84.35 % |
| Parental protein coverage: | 57.77 % |
| Number of stop codons detected: | 1 |
| Number of frameshifts detected: | 2 |
| Parental | MKRRIHLELRNRTPSDVKELVLDNCRSNDGKIEGLTAEFVNLEFLSLISVGLSTVSNLPELPKLKKLELS |
| MKR.IHLELRN.TPSDVKELV.DNCR.NDG.IEGL.AEFVNLEFL.LI.VG.STVSNL.EL.KLKKLELS | |
| Retrocopy | MKRSIHLELRNWTPSDVKELVPDNCRPNDGEIEGLMAEFVNLEFLNLIHVGWSTVSNLSELRKLKKLELS |
| Parental | DNRIFGGLD-VLAEKLPNLTHLNLSGNNLKDISTLEPLKKLEYLKSLDLFNCEVTNLNDYR-ESVFTLLP |
| DN.IFGGL..VLAEK.PNL.HLNLSGN.LKD.STLE.LKKLEYLKSLDLFNCEVTNLNDY...SVFTLLP | |
| Retrocopy | DNIIFGGLE<VLAEKFPNLIHLNLSGNELKDTSTLETLKKLEYLKSLDLFNCEVTNLNDYQ<KSVFTLLP |
| Parental | QLTYLDG |
| QLT.LDG | |
| Retrocopy | QLT*LDG |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP007412_brain | 0 .00 RPM | 0 .00 RPM |
| SRP007412_cerebellum | 0 .00 RPM | 0 .00 RPM |
| SRP007412_heart | 0 .00 RPM | 0 .00 RPM |
| SRP007412_kidney | 0 .00 RPM | 0 .00 RPM |
| SRP007412_liver | 0 .00 RPM | 0 .00 RPM |
| SRP007412_testis | 0 .00 RPM | 0 .00 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Choloepus hoffmanni | ENSCHOG00000005149 | 6 retrocopies | |
| Cavia porcellus | ENSCPOG00000020118 | 3 retrocopies | |
| Equus caballus | ENSECAG00000012310 | 2 retrocopies | |
| Echinops telfairi | ENSETEG00000015514 | 4 retrocopies | |
| Homo sapiens | ENSG00000136938 | 2 retrocopies | |
| Myotis lucifugus | ENSMLUG00000004844 | 2 retrocopies | |
| Macaca mulatta | ENSMMUG00000012242 | 1 retrocopy | |
| Monodelphis domestica | ENSMODG00000003261 | 1 retrocopy |
retro_mdom_763 ,
|
| Monodelphis domestica | ENSMODG00000027412 | 2 retrocopies | |
| Mustela putorius furo | ENSMPUG00000006433 | 1 retrocopy | |
| Mus musculus | ENSMUSG00000028333 | 1 retrocopy | |
| Nomascus leucogenys | ENSNLEG00000016941 | 1 retrocopy | |
| Otolemur garnettii | ENSOGAG00000006091 | 2 retrocopies | |
| Pongo abelii | ENSPPYG00000019430 | 2 retrocopies | |
| Pan troglodytes | ENSPTRG00000021172 | 3 retrocopies | |
| Pteropus vampyrus | ENSPVAG00000006569 | 1 retrocopy | |
| Sorex araneus | ENSSARG00000000804 | 1 retrocopy | |
| Tupaia belangeri | ENSTBEG00000002189 | 8 retrocopies | |
| Tursiops truncatus | ENSTTRG00000010825 | 2 retrocopies |