RetrogeneDB ID: | retro_ptro_1075 | ||
Retrocopylocation | Organism: | Chimpanzee (Pan troglodytes) | |
Coordinates: | 15:78779135..78779579(-) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | ANP32B | ||
Ensembl ID: | ENSPTRG00000021172 | ||
Aliases: | None | ||
Description: | None |
Percent Identity: | 88.51 % |
Parental protein coverage: | 58.96 % |
Number of stop codons detected: | 0 |
Number of frameshifts detected | 0 |
Parental | VRELVLDNCKSNDGKIEGLTAEFVNLEFLSLINVGLISVSNLPKLPKLKKLELSENRIFGGLDMLAEKLP |
VRE.VLDNCKSND.KIE.LTAEFVNLEFL.LINVGLIS.SNLPKLPKLKK..LSENRIFGGL.M.AEKLP | |
Retrocopy | VREHVLDNCKSNDWKIESLTAEFVNLEFLRLINVGLISISNLPKLPKLKKFVLSENRIFGGLNMFAEKLP |
Parental | NLTHLNLSGNKLKDISTLEPLKKLECLKSLDLFNCEVTNLNDYRESVFKLLPQLTYLDGYDREDQEAPDS |
NLTHLNLSG.KLKDISTLEPLKKLECLKSLDLFNCEV.NLNDY.ESVFKLLPQLT.LD.YD.EDQEAPDS | |
Retrocopy | NLTHLNLSGKKLKDISTLEPLKKLECLKSLDLFNCEVINLNDYQESVFKLLPQLTCLDTYDPEDQEAPDS |
Parental | DAEVDGVD |
.A.VDGVD | |
Retrocopy | EAQVDGVD |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP007412_brain_prefrontal_cortex | 0 .04 RPM | 36 .00 RPM |
SRP007412_cerebellum | 0 .00 RPM | 40 .58 RPM |
SRP007412_heart | 0 .00 RPM | 54 .12 RPM |
SRP007412_kidney | 0 .00 RPM | 55 .89 RPM |
SRP007412_liver | 0 .00 RPM | 94 .86 RPM |
SRP007412_testis | 0 .00 RPM | 78 .30 RPM |
Species | RetrogeneDB ID |
---|---|
Homo sapiens | retro_hsap_1603 |
Pongo abelii | retro_pabe_1316 |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Choloepus hoffmanni | ENSCHOG00000005149 | 6 retrocopies | |
Cavia porcellus | ENSCPOG00000020118 | 3 retrocopies | |
Equus caballus | ENSECAG00000012310 | 2 retrocopies | |
Echinops telfairi | ENSETEG00000015514 | 4 retrocopies | |
Homo sapiens | ENSG00000136938 | 2 retrocopies | |
Myotis lucifugus | ENSMLUG00000004844 | 2 retrocopies | |
Macaca mulatta | ENSMMUG00000012242 | 1 retrocopy | |
Monodelphis domestica | ENSMODG00000003261 | 1 retrocopy | |
Mustela putorius furo | ENSMPUG00000006433 | 1 retrocopy | |
Mus musculus | ENSMUSG00000028333 | 1 retrocopy | |
Nomascus leucogenys | ENSNLEG00000016941 | 1 retrocopy | |
Otolemur garnettii | ENSOGAG00000006091 | 2 retrocopies | |
Pan troglodytes | ENSPTRG00000007219 | 2 retrocopies | |
Pan troglodytes | ENSPTRG00000021172 | 3 retrocopies |
retro_ptro_1073, retro_ptro_1075 , retro_ptro_40,
|
Pteropus vampyrus | ENSPVAG00000006569 | 1 retrocopy | |
Sorex araneus | ENSSARG00000000804 | 1 retrocopy | |
Tupaia belangeri | ENSTBEG00000002189 | 8 retrocopies | |
Tursiops truncatus | ENSTTRG00000010825 | 2 retrocopies |