RetrogeneDB ID: | retro_mdom_901 | ||
Retrocopylocation | Organism: | Opossum (Monodelphis domestica) | |
Coordinates: | 2:365928630..365928870(-) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | None | ||
Ensembl ID: | ENSMODG00000017419 | ||
Aliases: | None | ||
Description: | None |
Percent Identity: | 67.9 % |
Parental protein coverage: | 58.7 % |
Number of stop codons detected: | 1 |
Number of frameshifts detected | 0 |
Parental | MAQDGEDERDYNLNEEQKAIKAKYPPAIRKYEYLDHTADVQLHAWGDTLEEAFEQCAMAMFGYMTDTGTV |
M.Q.GE.E.DYNLNEE.K..K.KY.....KY.YL..TA.V.LHAW.DTLEE.FEQCA..MFGYMTDTGT. | |
Retrocopy | MVQNGEYESDYNLNEE*KN-KDKYSQVFWKYKYLNPTAHVHLHAWEDTLEEPFEQCALVMFGYMTDTGTI |
Parental | EPLQTVEVQAE |
E.LQTVE..AE | |
Retrocopy | ESLQTVETKAE |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP007412_brain | 0 .00 RPM | 0 .00 RPM |
SRP007412_cerebellum | 0 .00 RPM | 0 .00 RPM |
SRP007412_heart | 0 .00 RPM | 0 .00 RPM |
SRP007412_kidney | 0 .00 RPM | 0 .00 RPM |
SRP007412_liver | 0 .00 RPM | 0 .00 RPM |
SRP007412_testis | 0 .00 RPM | 0 .00 RPM |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Canis familiaris | ENSCAFG00000010550 | 1 retrocopy | |
Choloepus hoffmanni | ENSCHOG00000004061 | 2 retrocopies | |
Cavia porcellus | ENSCPOG00000015349 | 2 retrocopies | |
Dasypus novemcinctus | ENSDNOG00000001861 | 2 retrocopies | |
Equus caballus | ENSECAG00000020982 | 1 retrocopy | |
Felis catus | ENSFCAG00000000700 | 1 retrocopy | |
Homo sapiens | ENSG00000176261 | 2 retrocopies | |
Gorilla gorilla | ENSGGOG00000007519 | 2 retrocopies | |
Myotis lucifugus | ENSMLUG00000000745 | 5 retrocopies | |
Macaca mulatta | ENSMMUG00000009939 | 1 retrocopy | |
Monodelphis domestica | ENSMODG00000017419 | 2 retrocopies |
retro_mdom_400, retro_mdom_901 ,
|
Mus musculus | ENSMUSG00000057572 | 1 retrocopy | |
Oryctolagus cuniculus | ENSOCUG00000000940 | 1 retrocopy | |
Otolemur garnettii | ENSOGAG00000011630 | 1 retrocopy | |
Pongo abelii | ENSPPYG00000001589 | 2 retrocopies | |
Tursiops truncatus | ENSTTRG00000014968 | 1 retrocopy |