RetrogeneDB ID: | retro_ttru_1200 | ||
Retrocopylocation | Organism: | Dolphin (Tursiops truncatus) | |
Coordinates: | scaffold_106996:5282..5525(-) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | ZBTB8OS | ||
Ensembl ID: | ENSTTRG00000014968 | ||
Aliases: | None | ||
Description: | zinc finger and BTB domain containing 8 opposite strand [Source:HGNC Symbol;Acc:24094] |
Percent Identity: | 51.81 % |
Parental protein coverage: | 55.7 % |
Number of stop codons detected: | 1 |
Number of frameshifts detected | 0 |
Parental | AMAMFGYMTDTGTVEPLQATEVETQGDDLQSLLFHFLNEWLYKFSADEFFIAREVKVLNIDQRNFKLRSI |
A.A.FG.M..TGT...LQ..E.ET.GDDL.S..FHFL...LYKFS.D..FI...VKVLN........... | |
Retrocopy | AIALFGFMIHTGTLNLLQMVEIETPGDDL*SPVFHFLDKGLYKFSTDLSFIPWDVKVLNTGXXXXNFLGW |
Parental | GWGEEFSLSKHPQ |
G..EE.SL.KH.Q | |
Retrocopy | G--EEYSLFKHLQ |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Canis familiaris | ENSCAFG00000010550 | 1 retrocopy | |
Choloepus hoffmanni | ENSCHOG00000004061 | 2 retrocopies | |
Cavia porcellus | ENSCPOG00000015349 | 2 retrocopies | |
Dasypus novemcinctus | ENSDNOG00000001861 | 2 retrocopies | |
Equus caballus | ENSECAG00000020982 | 1 retrocopy | |
Felis catus | ENSFCAG00000000700 | 1 retrocopy | |
Homo sapiens | ENSG00000176261 | 2 retrocopies | |
Gorilla gorilla | ENSGGOG00000007519 | 2 retrocopies | |
Myotis lucifugus | ENSMLUG00000000745 | 5 retrocopies | |
Macaca mulatta | ENSMMUG00000009939 | 1 retrocopy | |
Monodelphis domestica | ENSMODG00000017419 | 2 retrocopies | |
Mus musculus | ENSMUSG00000057572 | 1 retrocopy | |
Oryctolagus cuniculus | ENSOCUG00000000940 | 1 retrocopy | |
Otolemur garnettii | ENSOGAG00000011630 | 1 retrocopy | |
Pongo abelii | ENSPPYG00000001589 | 2 retrocopies | |
Tursiops truncatus | ENSTTRG00000014968 | 1 retrocopy |
retro_ttru_1200 ,
|