RetrogeneDB ID: | retro_meug_1503 | ||
Retrocopy location | Organism: | Wallaby (Macropus eugenii) | |
| Coordinates: | Scaffold427713:388..642(-) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | UBE2D3 | ||
| Ensembl ID: | ENSMEUG00000004256 | ||
| Aliases: | None | ||
| Description: | ubiquitin-conjugating enzyme E2D 3 [Source:HGNC Symbol;Acc:12476] |
| Percent Identity: | 83.72 % |
| Parental protein coverage: | 61.15 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected: | 1 |
| Parental | ELSDLARDPPAQCSAGPVGDD-MFHWQATIMGPNDSPYQGSVFFLTIHFPTDYPFKPPKVAFTTRIYHPN |
| .L.DLA.DPPAQCSAGPVGD...FHWQAT.M.PNDSPYQG.VFFLTIHFPTDYPFKPPKVAFTTR.YHP. | |
| Retrocopy | KLRDLACDPPAQCSAGPVGDI<LFHWQATVMVPNDSPYQGGVFFLTIHFPTDYPFKPPKVAFTTRMYHPS |
| Parental | INSNGSICLDILRSQW |
| I.SNGSICLDILRS.. | |
| Retrocopy | ISSNGSICLDILRSKF |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Choloepus hoffmanni | ENSCHOG00000004649 | 2 retrocopies | |
| Ciona intestinalis | ENSCING00000018711 | 2 retrocopies | |
| Callithrix jacchus | ENSCJAG00000015492 | 3 retrocopies | |
| Ciona savignyi | ENSCSAVG00000006136 | 1 retrocopy | |
| Dipodomys ordii | ENSDORG00000006762 | 2 retrocopies | |
| Equus caballus | ENSECAG00000020678 | 1 retrocopy | |
| Erinaceus europaeus | ENSEEUG00000014658 | 3 retrocopies | |
| Echinops telfairi | ENSETEG00000001291 | 3 retrocopies | |
| Gorilla gorilla | ENSGGOG00000001368 | 2 retrocopies | |
| Gorilla gorilla | ENSGGOG00000010832 | 1 retrocopy | |
| Macropus eugenii | ENSMEUG00000004256 | 6 retrocopies | |
| Macropus eugenii | ENSMEUG00000007238 | 1 retrocopy | |
| Macropus eugenii | ENSMEUG00000014517 | 1 retrocopy | |
| Ornithorhynchus anatinus | ENSOANG00000005415 | 1 retrocopy | |
| Pongo abelii | ENSPPYG00000014967 | 1 retrocopy | |
| Pteropus vampyrus | ENSPVAG00000015438 | 1 retrocopy | |
| Sus scrofa | ENSSSCG00000024306 | 1 retrocopy | |
| Sus scrofa | ENSSSCG00000029822 | 4 retrocopies | |
| Tupaia belangeri | ENSTBEG00000000270 | 5 retrocopies |