RetrogeneDB ID: | retro_mluc_1077 | ||
Retrocopylocation | Organism: | Microbat (Myotis lucifugus) | |
Coordinates: | GL429792:6268523..6268915(-) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | UBE2V2 | ||
Ensembl ID: | ENSMLUG00000002057 | ||
Aliases: | None | ||
Description: | None |
Percent Identity: | 52.17 % |
Parental protein coverage: | 91.72 % |
Number of stop codons detected: | 1 |
Number of frameshifts detected | 5 |
Parental | FRLLEELEEGQKG-VGDGT-VSWGLEDDEDMTLTRWTGMIIGPPRTNYENRIYSLK-VECGPKYPEAPPS |
F..LEE..EGQK...GDG...SWGLEDD...T..R..GM.IGP.R...EN.I.SLK...CGP.....P.. | |
Retrocopy | FLMLEEFKEGQKK>TGDGQ>LSWGLEDDRHDT--RGIGMPIGPQRKISEN*ICSLK<IKCGPNTQKHPAL |
Parental | VRFVTK-INMNGINNSSGMVDARSIPVLAKW-QNSYSIKVVLQELRRLMMSKENMKLPQPPEGQTYNN |
..F.TK.INMNG.N...G.V..R.I.VL.K..QNSYSI.VVLQ.L..L......MK...PPEG..Y.N | |
Retrocopy | KKFITK<INMNGVNSFNGWVKLRAILVLSKS<QNSYSIIVVLQGLQHLIVRXXXMKPSWPPEGWCYSN |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Canis familiaris | ENSCAFG00000028827 | 1 retrocopy | |
Cavia porcellus | ENSCPOG00000014413 | 4 retrocopies | |
Felis catus | ENSFCAG00000007602 | 6 retrocopies | |
Macropus eugenii | ENSMEUG00000016581 | 1 retrocopy | |
Myotis lucifugus | ENSMLUG00000002057 | 6 retrocopies | |
Macaca mulatta | ENSMMUG00000008223 | 1 retrocopy | |
Monodelphis domestica | ENSMODG00000010191 | 10 retrocopies | |
Mustela putorius furo | ENSMPUG00000001010 | 2 retrocopies | |
Oryctolagus cuniculus | ENSOCUG00000006933 | 1 retrocopy | |
Tupaia belangeri | ENSTBEG00000015720 | 27 retrocopies |
retro_tbel_1333, retro_tbel_1456, retro_tbel_1479, retro_tbel_1551, retro_tbel_160, retro_tbel_1740, retro_tbel_1784, retro_tbel_2129, retro_tbel_2149, retro_tbel_2317, retro_tbel_2334, retro_tbel_2496, retro_tbel_2890, retro_tbel_2935, retro_tbel_3021, retro_tbel_3102, retro_tbel_3141, retro_tbel_3461, retro_tbel_3573, retro_tbel_3734, retro_tbel_3935, retro_tbel_3971, retro_tbel_4227, retro_tbel_4319, retro_tbel_4720, retro_tbel_640, retro_tbel_909,
|