RetrogeneDB ID: | retro_mluc_1303 | ||
Retrocopy location | Organism: | Microbat (Myotis lucifugus) | |
| Coordinates: | GL429817:1886841..1887066(+) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | CKS1B | ||
| Ensembl ID: | ENSMLUG00000002408 | ||
| Aliases: | None | ||
| Description: | None |
| Percent Identity: | 81.33 % |
| Parental protein coverage: | 79.79 % |
| Number of stop codons detected: | 1 |
| Number of frameshifts detected: | 0 |
| Parental | MSHKQIYYSDKYDDEEFEYRHVMLPKDIAKLVPKTHLMSESEWRNLGVQQSQGWVHYMIHEPEPHILLFR |
| M.HKQIYYSDKY.DE..EYRHVMLP....K.VPKTHLMSE.EWR.LGVQQS.GWVHYMIHEPEPHIL.FR | |
| Retrocopy | MAHKQIYYSDKYFDEHYEYRHVMLPRELSKQVPKTHLMSEEEWRRLGVQQSLGWVHYMIHEPEPHILFFR |
| Parental | RPLPK |
| .PLPK | |
| Retrocopy | *PLPK |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Callithrix jacchus | ENSCJAG00000033635 | 10 retrocopies | |
| Cavia porcellus | ENSCPOG00000024061 | 2 retrocopies | |
| Dipodomys ordii | ENSDORG00000003764 | 6 retrocopies | |
| Homo sapiens | ENSG00000173207 | 1 retrocopy | |
| Gorilla gorilla | ENSGGOG00000013419 | 4 retrocopies | |
| Myotis lucifugus | ENSMLUG00000002408 | 1 retrocopy |
retro_mluc_1303 ,
|
| Otolemur garnettii | ENSOGAG00000006384 | 10 retrocopies | |
| Rattus norvegicus | ENSRNOG00000042561 | 1 retrocopy | |
| Sarcophilus harrisii | ENSSHAG00000004796 | 1 retrocopy |