RetrogeneDB ID: | retro_mmul_1215 | ||
Retrocopylocation | Organism: | Rhesus macaque (Macaca mulatta) | |
Coordinates: | 16:18542094..18542475(+) | ||
Located in intron of: | ENSMMUG00000005323 | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | RANBP1 | ||
Ensembl ID: | ENSMMUG00000020100 | ||
Aliases: | None | ||
Description: | ran-specific GTPase-activating protein [Source:RefSeq peptide;Acc:NP_001247793] |
Percent Identity: | 77.17 % |
Parental protein coverage: | 63.5 % |
Number of stop codons detected: | 3 |
Number of frameshifts detected | 0 |
Parental | LEEDEEELFKMRAKLFRFASENDLPEWKERGTGDVKLLKHKEKGAIRLLMRRDKTLKICANHYITPMMEL |
L.EDEEEL.KM..KLF.FASE.DLP.WKE.G.GD.KLLKHKEKG.IRLLM.RDKT.KICAN.Y.T.MMEL | |
Retrocopy | LGEDEEELLKM*MKLF*FASEKDLPKWKE*GIGDIKLLKHKEKGTIRLLMQRDKTVKICANRYFTLMMEL |
Parental | KPNAGSDRAWVWNTHADFADECPKPELLAIRFLNAENAQKFKTKFEECRKEIEEREK |
K.N.GSD.AWVWNTHA.FA..CPKPELLAIRFLN.ENAQKFKTKFEE..K.I.E..K | |
Retrocopy | KLNVGSDHAWVWNTHASFANKCPKPELLAIRFLNVENAQKFKTKFEEYKKKIREKRK |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP007412_brain | 0 .22 RPM | 29 .13 RPM |
SRP007412_brain_prefrontal_cortex | 0 .24 RPM | 29 .35 RPM |
SRP007412_cerebellum | 1 .10 RPM | 27 .64 RPM |
SRP007412_heart | 0 .12 RPM | 11 .95 RPM |
SRP007412_kidney | 0 .94 RPM | 22 .30 RPM |
SRP007412_liver | 0 .44 RPM | 16 .35 RPM |
SRP007412_testis | 0 .08 RPM | 84 .47 RPM |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Callithrix jacchus | ENSCJAG00000010749 | 1 retrocopy | |
Cavia porcellus | ENSCPOG00000002962 | 1 retrocopy | |
Dipodomys ordii | ENSDORG00000011317 | 2 retrocopies | |
Echinops telfairi | ENSETEG00000015996 | 2 retrocopies | |
Homo sapiens | ENSG00000099901 | 2 retrocopies | |
Gorilla gorilla | ENSGGOG00000000784 | 1 retrocopy | |
Macropus eugenii | ENSMEUG00000016620 | 8 retrocopies | |
Myotis lucifugus | ENSMLUG00000017535 | 1 retrocopy | |
Macaca mulatta | ENSMMUG00000020100 | 1 retrocopy |
retro_mmul_1215 ,
|
Monodelphis domestica | ENSMODG00000010312 | 5 retrocopies | |
Mus musculus | ENSMUSG00000005732 | 1 retrocopy | |
Nomascus leucogenys | ENSNLEG00000005684 | 2 retrocopies | |
Otolemur garnettii | ENSOGAG00000034333 | 2 retrocopies | |
Pongo abelii | ENSPPYG00000011593 | 4 retrocopies | |
Rattus norvegicus | ENSRNOG00000001884 | 4 retrocopies | |
Sarcophilus harrisii | ENSSHAG00000006873 | 1 retrocopy | |
Ictidomys tridecemlineatus | ENSSTOG00000026840 | 2 retrocopies |