RetrogeneDB ID: | retro_pabe_1470 | ||
Retrocopylocation | Organism: | Orangutan (Pongo abelii) | |
Coordinates: | 17:68568479..68568773(+) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | RANBP1 | ||
Ensembl ID: | ENSPPYG00000011593 | ||
Aliases: | None | ||
Description: | RAN binding protein 1 [Source:HGNC Symbol;Acc:9847] |
Percent Identity: | 65.38 % |
Parental protein coverage: | 50.25 % |
Number of stop codons detected: | 0 |
Number of frameshifts detected | 3 |
Parental | ANHYITPMMELKPNAGSDRAWVWNTHADFADEC-PKPELLAIRFLNAENAQKFKTKFEECRK-EIEEREK |
A....TPMM.LKPNA.S.RAWV.NTHADF...C.P.PELLA.RFLNAE.A.KF....E...K..I.ER.K | |
Retrocopy | ASPKVTPMMKLKPNAVSHRAWVCNTHADFTHGC<PRPELLAGRFLNAEHARKFQSS-ENAKK<DIKERQK |
Parental | KAGSGKNDHAEKVAEKLEALSV-KEETKEDAEEK |
K.G.GKN..AEKV.EKLEAL...KEETKED.EEK | |
Retrocopy | K-GPGKNNNAEKVVEKLEALLL<KEETKEDTEEK |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP007412_brain_prefrontal_cortex | 0 .00 RPM | 17 .31 RPM |
SRP007412_cerebellum | 0 .00 RPM | 21 .52 RPM |
SRP007412_heart | 0 .00 RPM | 5 .21 RPM |
SRP007412_kidney | 0 .00 RPM | 10 .97 RPM |
SRP007412_liver | 0 .00 RPM | 15 .03 RPM |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Callithrix jacchus | ENSCJAG00000010749 | 1 retrocopy | |
Cavia porcellus | ENSCPOG00000002962 | 1 retrocopy | |
Dipodomys ordii | ENSDORG00000011317 | 2 retrocopies | |
Echinops telfairi | ENSETEG00000015996 | 2 retrocopies | |
Homo sapiens | ENSG00000099901 | 2 retrocopies | |
Gorilla gorilla | ENSGGOG00000000784 | 1 retrocopy | |
Macropus eugenii | ENSMEUG00000016620 | 8 retrocopies | |
Myotis lucifugus | ENSMLUG00000017535 | 1 retrocopy | |
Macaca mulatta | ENSMMUG00000020100 | 1 retrocopy | |
Monodelphis domestica | ENSMODG00000010312 | 5 retrocopies | |
Mus musculus | ENSMUSG00000005732 | 1 retrocopy | |
Nomascus leucogenys | ENSNLEG00000005684 | 2 retrocopies | |
Otolemur garnettii | ENSOGAG00000034333 | 2 retrocopies | |
Pongo abelii | ENSPPYG00000011593 | 4 retrocopies | |
Rattus norvegicus | ENSRNOG00000001884 | 4 retrocopies | |
Sarcophilus harrisii | ENSSHAG00000006873 | 1 retrocopy | |
Ictidomys tridecemlineatus | ENSSTOG00000026840 | 2 retrocopies |