RetrogeneDB ID: | retro_mmul_2138 | ||
Retrocopy location | Organism: | Rhesus macaque (Macaca mulatta) | |
| Coordinates: | 7:27479207..27479641(+) | ||
| Located in intron of: | ENSMMUG00000009839 | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | MMU.2365 | ||
| Ensembl ID: | ENSMMUG00000018843 | ||
| Aliases: | None | ||
| Description: | NADH dehydrogenase [Source:RefSeq peptide;Acc:NP_001247683] |
| Percent Identity: | 76.03 % |
| Parental protein coverage: | 82.86 % |
| Number of stop codons detected: | 1 |
| Number of frameshifts detected: | 1 |
| Parental | ENRA-EREISKIKPSLAPRHPSTSNLLQEQISHYPEIKGEIARKDDKLLSFLKDVYVDSKDPVSSLQVKA |
| ENRA.ERE......S.APRHPST..LL.E.I..Y.E.KGEIARK.DKLLSFLK.VYVDSKDP.SS.QV.. | |
| Retrocopy | ENRA<EREVGNKNLSPAPRHPSTYSLLSERIRVYQEMKGEIARKHDKLLSFLKYVYVDSKDPLSSVQVET |
| Parental | AETCQEPKEFRLPKGHQFGMINMKSIPKGKISVVEALTLLNNHKLYPETWTAEKIVQEYQLEKKDVNSLL |
| .ET.QEPKEFRLPKGH.F.MIN.KSIPKGKIS.VE.LTL..NHKLYPET.TAEK.VQEY.LE.KDVNSLL | |
| Retrocopy | TETHQEPKEFRLPKGHHFDMINIKSIPKGKISIVETLTLFSNHKLYPET*TAEKRVQEYNLEQKDVNSLL |
| Parental | KYFVTF |
| KYFVTF | |
| Retrocopy | KYFVTF |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP007412_brain | 0 .00 RPM | 17 .14 RPM |
| SRP007412_brain_prefrontal_cortex | 0 .00 RPM | 10 .95 RPM |
| SRP007412_cerebellum | 0 .00 RPM | 12 .01 RPM |
| SRP007412_heart | 0 .00 RPM | 8 .42 RPM |
| SRP007412_kidney | 0 .00 RPM | 9 .39 RPM |
| SRP007412_liver | 0 .00 RPM | 2 .65 RPM |
| SRP007412_testis | 0 .00 RPM | 2 .94 RPM |
| Species | RetrogeneDB ID |
|---|---|
| Homo sapiens | retro_hsap_1494 |
| Pan troglodytes | retro_ptro_1013 |
| Gorilla gorilla | retro_ggor_1147 |
| Pongo abelii | retro_pabe_1244 |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Bos taurus | ENSBTAG00000003174 | 1 retrocopy | |
| Choloepus hoffmanni | ENSCHOG00000005145 | 2 retrocopies | |
| Callithrix jacchus | ENSCJAG00000001235 | 2 retrocopies | |
| Cavia porcellus | ENSCPOG00000007618 | 1 retrocopy | |
| Homo sapiens | ENSG00000123545 | 4 retrocopies | |
| Gorilla gorilla | ENSGGOG00000012070 | 4 retrocopies | |
| Microcebus murinus | ENSMICG00000015734 | 1 retrocopy | |
| Macaca mulatta | ENSMMUG00000018843 | 4 retrocopies | |
| Mus musculus | ENSMUSG00000028261 | 3 retrocopies | |
| Nomascus leucogenys | ENSNLEG00000013568 | 4 retrocopies | |
| Oryctolagus cuniculus | ENSOCUG00000002152 | 1 retrocopy | |
| Pongo abelii | ENSPPYG00000016857 | 4 retrocopies | |
| Pan troglodytes | ENSPTRG00000018435 | 4 retrocopies | |
| Rattus norvegicus | ENSRNOG00000007506 | 3 retrocopies | |
| Tursiops truncatus | ENSTTRG00000010911 | 1 retrocopy |