RetrogeneDB ID: | retro_ptro_1877 | ||
Retrocopylocation | Organism: | Chimpanzee (Pan troglodytes) | |
Coordinates: | 3:38375578..38375959(-) | ||
Located in intron of: | ENSPTRG00000014748 | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | NDUFAF4 | ||
Ensembl ID: | ENSPTRG00000018435 | ||
Aliases: | None | ||
Description: | None |
Percent Identity: | 86.61 % |
Parental protein coverage: | 72.57 % |
Number of stop codons detected: | 2 |
Number of frameshifts detected | 0 |
Parental | GALVIRGIRNFNLENRAEREISKMKPSVAPRHPSTNSLLREQISLYPEVKGEIACKDEKLLSFLKDVYVD |
GA.V.R.IR.FN.ENRAE.EISKMKPS.APRHPSTNSLL.EQISLYPE.KGEIA.KD.KLL.FLKDVYVD | |
Retrocopy | GAAVTRRIRHFN*ENRAEWEISKMKPSPAPRHPSTNSLL*EQISLYPEIKGEIAHKDDKLLPFLKDVYVD |
Parental | SKDPVSSLQVKAAETCQEPKEFRLPKDHHFDMINIKSIPKGKISIVEALTLLNNHKL |
SKD.VSS.QVKAAET.QEPKEFRL.K.HHFDMINIKSIPKGKISIVEALTLLNNHKL | |
Retrocopy | SKDLVSSAQVKAAETHQEPKEFRLLKGHHFDMINIKSIPKGKISIVEALTLLNNHKL |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP007412_brain_prefrontal_cortex | 0 .14 RPM | 17 .93 RPM |
SRP007412_cerebellum | 0 .04 RPM | 12 .12 RPM |
SRP007412_heart | 0 .06 RPM | 15 .59 RPM |
SRP007412_kidney | 0 .10 RPM | 10 .36 RPM |
SRP007412_liver | 0 .03 RPM | 7 .46 RPM |
SRP007412_testis | 0 .00 RPM | 4 .43 RPM |
Species | RetrogeneDB ID |
---|---|
Homo sapiens | retro_hsap_2774 |
Gorilla gorilla | retro_ggor_1931 |
Pongo abelii | retro_pabe_2241 |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Bos taurus | ENSBTAG00000003174 | 1 retrocopy | |
Choloepus hoffmanni | ENSCHOG00000005145 | 2 retrocopies | |
Callithrix jacchus | ENSCJAG00000001235 | 2 retrocopies | |
Cavia porcellus | ENSCPOG00000007618 | 1 retrocopy | |
Homo sapiens | ENSG00000123545 | 4 retrocopies | |
Gorilla gorilla | ENSGGOG00000012070 | 4 retrocopies | |
Microcebus murinus | ENSMICG00000015734 | 1 retrocopy | |
Macaca mulatta | ENSMMUG00000018843 | 4 retrocopies | |
Mus musculus | ENSMUSG00000028261 | 3 retrocopies | |
Nomascus leucogenys | ENSNLEG00000013568 | 4 retrocopies | |
Oryctolagus cuniculus | ENSOCUG00000002152 | 1 retrocopy | |
Pongo abelii | ENSPPYG00000016857 | 4 retrocopies | |
Pan troglodytes | ENSPTRG00000018435 | 4 retrocopies | |
Rattus norvegicus | ENSRNOG00000007506 | 3 retrocopies | |
Tursiops truncatus | ENSTTRG00000010911 | 1 retrocopy |