RetrogeneDB ID: | retro_mmus_1293 | ||
Retrocopy location | Organism: | Mouse (Mus musculus) | |
| Coordinates: | 14:76636540..76636864(-) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | Fkbp1a | ||
| Ensembl ID: | ENSMUSG00000032966 | ||
| Aliases: | Fkbp1a, 12kDa, FKBP12, FKBP12-T1, FKBP12-T2, Fkbp, Fkbp1, mFKBP1, mFKBP12 | ||
| Description: | FK506 binding protein 1a [Source:MGI Symbol;Acc:MGI:95541] |
| Percent Identity: | 87.04 % |
| Parental protein coverage: | 100.0 % |
| Number of stop codons detected: | 1 |
| Number of frameshifts detected: | 0 |
| Parental | MGVQVETISPGDGRTFPKRGQTCVVHYTGMLEDGKKFDSSRDRNKPFKFTLGKQEVIRGWEEGVAQMSVG |
| MG.QVETISPGD..TFPK..Q.C.VHYTGMLEDGKKF.SSRDRN.PFKFTLGKQEVIRGW.EGVAQMSVG | |
| Retrocopy | MGMQVETISPGDRCTFPKHSQNCMVHYTGMLEDGKKFASSRDRNNPFKFTLGKQEVIRGWKEGVAQMSVG |
| Parental | QRAKLIISSDYAYGATGHPGIIPPHATLVFDVELLKLE |
| .RAKLIIS.DYAYG.TGHPGIIPPHATLVFDVE.LKLE | |
| Retrocopy | HRAKLIIS*DYAYGTTGHPGIIPPHATLVFDVEHLKLE |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP007412_brain | 0 .02 RPM | 377 .80 RPM |
| SRP007412_cerebellum | 0 .09 RPM | 188 .27 RPM |
| SRP007412_heart | 0 .06 RPM | 129 .38 RPM |
| SRP007412_kidney | 0 .02 RPM | 107 .95 RPM |
| SRP007412_liver | 0 .00 RPM | 49 .16 RPM |
| SRP007412_testis | 0 .05 RPM | 231 .90 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Bos taurus | ENSBTAG00000008303 | 4 retrocopies | |
| Ciona savignyi | ENSCSAVG00000006859 | 1 retrocopy | |
| Dasypus novemcinctus | ENSDNOG00000005868 | 16 retrocopies | |
| Homo sapiens | ENSG00000088832 | 1 retrocopy | |
| Gorilla gorilla | ENSGGOG00000001729 | 3 retrocopies | |
| Macaca mulatta | ENSMMUG00000015996 | 1 retrocopy | |
| Monodelphis domestica | ENSMODG00000019554 | 2 retrocopies | |
| Mus musculus | ENSMUSG00000020949 | 1 retrocopy | |
| Mus musculus | ENSMUSG00000032966 | 1 retrocopy |
retro_mmus_1293 ,
|
| Procavia capensis | ENSPCAG00000008816 | 2 retrocopies | |
| Rattus norvegicus | ENSRNOG00000008822 | 1 retrocopy | |
| Sus scrofa | ENSSSCG00000007188 | 1 retrocopy | |
| Tursiops truncatus | ENSTTRG00000003547 | 3 retrocopies | |
| Vicugna pacos | ENSVPAG00000011511 | 1 retrocopy |