RetrogeneDB ID:

retro_mmus_2545

Retrocopy
location
Organism:Mouse (Mus musculus)
Coordinates:5:8971947..8972139(+)
Located in intron of:ENSMUSG00000003623
Retrocopy
information
Ensembl ID:ENSMUSG00000078183
Aliases:None
Status:KNOWN_PSEUDOGENE
Parental gene
information
Parental gene summary:
Parental gene symbol:Tma7
Ensembl ID:ENSMUSG00000091537
Aliases:Tma7, 1110017O22Rik, Ccdc72
Description:translational machinery associated 7 homolog (S. cerevisiae) [Source:MGI Symbol;Acc:MGI:1913417]


Retrocopy-Parental alignment summary:






>retro_mmus_2545
ATGTCGGGCTGGGAAGGTGGCAAAAAGAAGCCCCTGAAACAGCCCAAGAAGCAGGCCAAGGAGATGGACGAGGAAGATAA
GGCTTTCAAGCAGAATCAAAAGGAGGAACGGAAGAAACTCGAGGAGCTAAAAGCCAAGGCCGCCGGGAAGGGCCCCCTGG
CCACAGGTGGAATTAAGAAATCTGGCAAAAAG

ORF - retro_mmus_2545 Open Reading Frame is conserved.
Retrocopy - Parental Gene Alignment summary:
Percent Identity: 95.31 %
Parental protein coverage: 100. %
Number of stop codons detected: 0
Number of frameshifts detected 0


Retrocopy - Parental Gene Alignment:

ParentalMSGREGGKKKPLKQPKKQAKEMDEEDKAFKQKQKEEQKKLEELKAKAAGKGPLATGGIKKSGKK
MSG.EGGKKKPLKQPKKQAKEMDEEDKAFKQ.QKEE.KKLEELKAKAAGKGPLATGGIKKSGKK
RetrocopyMSGWEGGKKKPLKQPKKQAKEMDEEDKAFKQNQKEERKKLEELKAKAAGKGPLATGGIKKSGKK

Legend:
*Stop codon
>Forward frameshift by one nucleotide
<Reverse frameshift by one nucleotide






(Hint: click retrocopy or parental gene accession number on the plot's legend, to show / hide expression level values)

Expression validation based on RNA-Seq data:
Library Retrocopy expression Parental gene expression
SRP007412_brain 0 .12 RPM 10 .07 RPM
SRP007412_cerebellum 0 .17 RPM 7 .08 RPM
SRP007412_heart 0 .00 RPM 17 .53 RPM
SRP007412_kidney 0 .33 RPM 15 .34 RPM
SRP007412_liver 0 .25 RPM 11 .03 RPM
SRP007412_testis 0 .69 RPM 15 .14 RPM
RNA Polymerase II actvity near the 5' end of retro_mmus_2545 was not detected
No EST(s) were mapped for retro_mmus_2545 retrocopy.


TSS No. TSS Name TSS expression level (Expr) in TPM range:
no expression 0 < Expr ≤ 1 1 < Expr ≤ 5 5 < Expr ≤ 10 Expr > 10
TSS #1 TSS_116072532 libraries238 libraries276 libraries24 libraries2 libraries

The graphical summary, for retro_mmus_2545 TSS expression levels > 0 TPM .
TSS expression levels were studied across 1072 TSS-CAGE libraries, based on FANTOM5 data.
The expression values were visualized using beanplot. If you have any doubts, how to read it, read more in Kampstra P (2008)

retro_mmus_2545 was not experimentally validated.

Retrocopy orthology:
Retrocopy retro_mmus_2545 has 0 orthologous retrocopies within eutheria group .


Parental genes homology:
Parental genes homology involve 9 parental genes, and 61 retrocopies.

Species Parental gene accession Retrocopies number
Ailuropoda melanoleuca ENSAMEG000000011936 retrocopies
Callithrix jacchus ENSCJAG0000000287118 retrocopies
Felis catus ENSFCAG000000269025 retrocopies
Gorilla gorilla ENSGGOG000000280443 retrocopies
Mus musculus ENSMUSG00000091537 11 retrocopies
Pan troglodytes ENSPTRG000000417699 retrocopies
Rattus norvegicus ENSRNOG000000426892 retrocopies
Rattus norvegicus ENSRNOG000000472251 retrocopy
Sus scrofa ENSSSCG000000113516 retrocopies



Copyright © RetrogeneDB 2014-2017