RetrogeneDB ID: | retro_mmus_2975 | ||
Retrocopylocation | Organism: | Mouse (Mus musculus) | |
Coordinates: | 7:128340466..128340658(+) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | Tma7 | ||
Ensembl ID: | ENSMUSG00000091537 | ||
Aliases: | Tma7, 1110017O22Rik, Ccdc72 | ||
Description: | translational machinery associated 7 homolog (S. cerevisiae) [Source:MGI Symbol;Acc:MGI:1913417] |
Percent Identity: | 98.44 % |
Parental protein coverage: | 100. % |
Number of stop codons detected: | 0 |
Number of frameshifts detected | 0 |
Parental | MSGREGGKKKPLKQPKKQAKEMDEEDKAFKQKQKEEQKKLEELKAKAAGKGPLATGGIKKSGKK |
MSGREGGKKKPLKQPKKQAKEMDEEDKAFKQKQKEEQKKLEELKAKAAGKG.LATGGIKKSGKK | |
Retrocopy | MSGREGGKKKPLKQPKKQAKEMDEEDKAFKQKQKEEQKKLEELKAKAAGKGLLATGGIKKSGKK |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP007412_brain | 0 .23 RPM | 10 .07 RPM |
SRP007412_cerebellum | 2 .43 RPM | 7 .08 RPM |
SRP007412_heart | 0 .00 RPM | 17 .53 RPM |
SRP007412_kidney | 1 .77 RPM | 15 .34 RPM |
SRP007412_liver | 0 .76 RPM | 11 .03 RPM |
SRP007412_testis | 2 .93 RPM | 15 .14 RPM |
TSS No. | TSS Name | TSS expression level (Expr) in TPM range: | ||||
---|---|---|---|---|---|---|
no expression | 0 < Expr ≤ 1 | 1 < Expr ≤ 5 | 5 < Expr ≤ 10 | Expr > 10 | ||
TSS #1 | TSS_129486 | 282 libraries | 303 libraries | 473 libraries | 13 libraries | 1 library |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Ailuropoda melanoleuca | ENSAMEG00000001193 | 6 retrocopies | |
Callithrix jacchus | ENSCJAG00000002871 | 18 retrocopies |
retro_cjac_1370, retro_cjac_1449, retro_cjac_1504, retro_cjac_1667, retro_cjac_1670, retro_cjac_1704, retro_cjac_1918, retro_cjac_2092, retro_cjac_2258, retro_cjac_2422, retro_cjac_2629, retro_cjac_2673, retro_cjac_2692, retro_cjac_2799, retro_cjac_3651, retro_cjac_536, retro_cjac_81, retro_cjac_849,
|
Felis catus | ENSFCAG00000026902 | 5 retrocopies | |
Gorilla gorilla | ENSGGOG00000028044 | 3 retrocopies | |
Mus musculus | ENSMUSG00000091537 | 11 retrocopies |
retro_mmus_1216, retro_mmus_1582, retro_mmus_1632, retro_mmus_2117, retro_mmus_2189, retro_mmus_2222, retro_mmus_2545, retro_mmus_2975 , retro_mmus_3235, retro_mmus_389, retro_mmus_412,
|
Pan troglodytes | ENSPTRG00000041769 | 9 retrocopies | |
Rattus norvegicus | ENSRNOG00000042689 | 2 retrocopies | |
Rattus norvegicus | ENSRNOG00000047225 | 1 retrocopy | |
Sus scrofa | ENSSSCG00000011351 | 6 retrocopies |