RetrogeneDB ID: | retro_sscr_19 | ||
Retrocopylocation | Organism: | Pig (Sus scrofa) | |
Coordinates: | JH118898.1:145746..145926(-) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | ENSSSCG00000002745 | |
Aliases: | None | ||
Status: | KNOWN_PROTEIN_CODING | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | TMA7 | ||
Ensembl ID: | ENSSSCG00000011351 | ||
Aliases: | None | ||
Description: | translation machinery associated 7 homolog (S. cerevisiae) [Source:HGNC Symbol;Acc:26932] |
Percent Identity: | 72.31 % |
Parental protein coverage: | 100. % |
Number of stop codons detected: | 0 |
Number of frameshifts detected | 0 |
Parental | MSGREGGKKKPLKQPKKQAKEMDEEDKAFKQKQKEEQKKLEELKAKAAG-KGPLATGGIKKSGKK |
MSGR.G.K.....QP.KQAKE..EED.AFKQKQ.EEQK..EEL.AKA.G.KGPLAT.GIKKSGKK | |
Retrocopy | MSGRGGVKE----QPQKQAKETEEEDAAFKQKQ-EEQKEREELEAKASGGKGPLATSGIKKSGKK |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP014902_placenta | 0 .00 RPM | 16 .33 RPM |
SRP014902_testis | 0 .14 RPM | 62 .66 RPM |
SRP018288_heart | 0 .03 RPM | 81 .49 RPM |
SRP018288_kidney | 0 .00 RPM | 118 .21 RPM |
SRP018288_liver | 0 .16 RPM | 71 .80 RPM |
SRP018288_lung | 0 .00 RPM | 12 .93 RPM |
SRP018856_adipose | 0 .00 RPM | 154 .81 RPM |
SRP035408_brain | 0 .22 RPM | 101 .95 RPM |
SRP035408_liver | 0 .00 RPM | 62 .18 RPM |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Ailuropoda melanoleuca | ENSAMEG00000001193 | 6 retrocopies | |
Callithrix jacchus | ENSCJAG00000002871 | 18 retrocopies |
retro_cjac_1370, retro_cjac_1449, retro_cjac_1504, retro_cjac_1667, retro_cjac_1670, retro_cjac_1704, retro_cjac_1918, retro_cjac_2092, retro_cjac_2258, retro_cjac_2422, retro_cjac_2629, retro_cjac_2673, retro_cjac_2692, retro_cjac_2799, retro_cjac_3651, retro_cjac_536, retro_cjac_81, retro_cjac_849,
|
Felis catus | ENSFCAG00000026902 | 5 retrocopies | |
Homo sapiens | ENSG00000232112 | 11 retrocopies | |
Gorilla gorilla | ENSGGOG00000028044 | 3 retrocopies | |
Mus musculus | ENSMUSG00000091537 | 11 retrocopies | |
Pan troglodytes | ENSPTRG00000041769 | 9 retrocopies | |
Rattus norvegicus | ENSRNOG00000042689 | 2 retrocopies | |
Rattus norvegicus | ENSRNOG00000047225 | 1 retrocopy | |
Sus scrofa | ENSSSCG00000011351 | 6 retrocopies |