RetrogeneDB ID: | retro_mmus_398 | ||
Retrocopy location | Organism: | Mouse (Mus musculus) | |
| Coordinates: | 1:182071494..182071764(+) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | Rps11 | ||
| Ensembl ID: | ENSMUSG00000003429 | ||
| Aliases: | None | ||
| Description: | ribosomal protein S11 [Source:MGI Symbol;Acc:MGI:1351329] |
| Percent Identity: | 53.33 % |
| Parental protein coverage: | 56.96 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected: | 0 |
| Parental | KTPKEAIEGTYIDKKCPFTGNVSIRGRILSGVVTKMKMQRTIVIRRDYLHYIRKYNRFEKRHKNMSVHLS |
| K.P..AIEGTY.DKK..........GR.L.GV..K.K...T.V.....L.YI.KY..FEK.HK..SV.L. | |
| Retrocopy | KMPIAAIEGTYTDKKHSLLARTPSKGRSLAGVERKVKVLWTVVLHGYHLWYIHKYSHFEKCHKSVSVDLF |
| Parental | PCFRDVQIGDIVTVGECRPL |
| P.FR.VQI.DI.T.GECRPL | |
| Retrocopy | PFFRTVQISDIITMGECRPL |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP007412_brain | 0 .05 RPM | 79 .81 RPM |
| SRP007412_cerebellum | 0 .00 RPM | 69 .13 RPM |
| SRP007412_heart | 0 .00 RPM | 118 .45 RPM |
| SRP007412_kidney | 0 .00 RPM | 111 .74 RPM |
| SRP007412_liver | 0 .00 RPM | 98 .26 RPM |
| SRP007412_testis | 0 .00 RPM | 77 .71 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Canis familiaris | ENSCAFG00000003631 | 9 retrocopies | |
| Danio rerio | ENSDARG00000053058 | 1 retrocopy | |
| Dipodomys ordii | ENSDORG00000012195 | 1 retrocopy | |
| Equus caballus | ENSECAG00000000370 | 1 retrocopy | |
| Felis catus | ENSFCAG00000009196 | 13 retrocopies | |
| Microcebus murinus | ENSMICG00000002542 | 8 retrocopies | |
| Monodelphis domestica | ENSMODG00000013434 | 7 retrocopies | |
| Mus musculus | ENSMUSG00000003429 | 16 retrocopies | |
| Otolemur garnettii | ENSOGAG00000004627 | 7 retrocopies | |
| Pan troglodytes | ENSPTRG00000011299 | 1 retrocopy | |
| Rattus norvegicus | ENSRNOG00000020595 | 18 retrocopies | |
| Ictidomys tridecemlineatus | ENSSTOG00000023443 | 2 retrocopies | |
| Tupaia belangeri | ENSTBEG00000016677 | 16 retrocopies |