RetrogeneDB ID: | retro_nleu_2410 | ||
Retrocopy location | Organism: | Gibbon (Nomascus leucogenys) | |
| Coordinates: | GL397353.1:2130414..2130849(+) | ||
| Located in intron of: | ENSNLEG00000013319 | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | None | ||
| Ensembl ID: | ENSNLEG00000027034 | ||
| Aliases: | None | ||
| Description: | None |
| Percent Identity: | 53.64 % |
| Parental protein coverage: | 68.52 % |
| Number of stop codons detected: | 3 |
| Number of frameshifts detected: | 3 |
| Parental | VANNFVTDKNSGE-VMTVGINAIKEITARCPLAMTEELLQDLAQYKTHKDKNVMMSARTLIQLFRTLNPQ |
| VA.N.V...N.G..VMTVGIN.IK..T...P.....E...........K.KNV..SAR.LI..F...N.Q | |
| Retrocopy | VASNSVKERNPGV<VMTVGINVIKKVTT*YPRIVIKEPAS-ISPRRIYKHKNVIISARILILFF*VPNSQ |
| Parental | MLQKKFRGKPTEASIEARVQEYGELDAKDYIPGAEVL-EVEKEENAENDEEGWESTSISEEEDADGEWID |
| .LQK.F.GKPTEAS.EARVQEYG.L.A.DYI.G...L.EV.K.EN..N..EGW.STS..EE.DA.G...D | |
| Retrocopy | ILQKRFWGKPTEASTEARVQEYG*LNATDYISGGGIL<EV-KKENVVNRDEGWGSTSPEEEGDAHGGLVD |
| Parental | VFHSS-DEEQQ |
| ..HSS..EEQQ | |
| Retrocopy | MCHSS<CEEQQ |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Canis familiaris | ENSCAFG00000008521 | 2 retrocopies | |
| Cavia porcellus | ENSCPOG00000008524 | 2 retrocopies | |
| Echinops telfairi | ENSETEG00000004811 | 2 retrocopies | |
| Homo sapiens | ENSG00000198301 | 2 retrocopies | |
| Gorilla gorilla | ENSGGOG00000006441 | 1 retrocopy | |
| Loxodonta africana | ENSLAFG00000012217 | 1 retrocopy | |
| Microcebus murinus | ENSMICG00000006682 | 1 retrocopy | |
| Macaca mulatta | ENSMMUG00000017503 | 1 retrocopy | |
| Nomascus leucogenys | ENSNLEG00000027034 | 1 retrocopy |
retro_nleu_2410 ,
|
| Oryctolagus cuniculus | ENSOCUG00000026953 | 1 retrocopy | |
| Pongo abelii | ENSPPYG00000014852 | 1 retrocopy | |
| Pan troglodytes | ENSPTRG00000024399 | 2 retrocopies | |
| Rattus norvegicus | ENSRNOG00000022229 | 2 retrocopies | |
| Sus scrofa | ENSSSCG00000008974 | 1 retrocopy | |
| Tupaia belangeri | ENSTBEG00000005270 | 1 retrocopy |