RetrogeneDB ID: | retro_ogar_1267 | ||
Retrocopy location | Organism: | Bushbaby (Otolemur garnettii) | |
| Coordinates: | GL873540.1:24629256..24629526(-) | ||
| Located in intron of: | ENSOGAG00000000478 | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | ISCA1 | ||
| Ensembl ID: | ENSOGAG00000015628 | ||
| Aliases: | None | ||
| Description: | iron-sulfur cluster assembly 1 homolog (S. cerevisiae) [Source:HGNC Symbol;Acc:28660] |
| Percent Identity: | 74.73 % |
| Parental protein coverage: | 70.54 % |
| Number of stop codons detected: | 2 |
| Number of frameshifts detected: | 0 |
| Parental | TRAALTLTPSAVNKIKQLLKDKPEHVGVKVGVRTRGCNGLSYTLEYTKTKGDSDEEVVQDGVRVFIEKKA |
| .R......PS.VNKIKQLLKDK.EHVG.KV.V.TRGCNGL.YTLEYTKTKGD.D.EVVQD.VRVFIEK.. | |
| Retrocopy | SRSCRLPSPSVVNKIKQLLKDKLEHVGMKVSV*TRGCNGLYYTLEYTKTKGDPD-EVVQDRVRVFIEKEV |
| Parental | QLTLLGTEMDYVEDKLSSEFV |
| .LT.LGTEMD.VEDK.S.EFV | |
| Retrocopy | *LTILGTEMDSVEDKFSNEFV |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Bos taurus | ENSBTAG00000046526 | 2 retrocopies | |
| Callithrix jacchus | ENSCJAG00000001940 | 6 retrocopies | |
| Cavia porcellus | ENSCPOG00000011872 | 2 retrocopies | |
| Dasypus novemcinctus | ENSDNOG00000010652 | 5 retrocopies | |
| Echinops telfairi | ENSETEG00000016537 | 1 retrocopy | |
| Gorilla gorilla | ENSGGOG00000007518 | 2 retrocopies | |
| Microcebus murinus | ENSMICG00000003889 | 1 retrocopy | |
| Monodelphis domestica | ENSMODG00000003559 | 1 retrocopy | |
| Mus musculus | ENSMUSG00000044792 | 1 retrocopy | |
| Otolemur garnettii | ENSOGAG00000015628 | 5 retrocopies | |
| Pongo abelii | ENSPPYG00000019339 | 5 retrocopies | |
| Rattus norvegicus | ENSRNOG00000018343 | 4 retrocopies | |
| Tarsius syrichta | ENSTSYG00000012826 | 2 retrocopies |