RetrogeneDB ID: | retro_ogar_1267 | ||
Retrocopylocation | Organism: | Bushbaby (Otolemur garnettii) | |
Coordinates: | GL873540.1:24629256..24629526(-) | ||
Located in intron of: | ENSOGAG00000000478 | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | ISCA1 | ||
Ensembl ID: | ENSOGAG00000015628 | ||
Aliases: | None | ||
Description: | iron-sulfur cluster assembly 1 homolog (S. cerevisiae) [Source:HGNC Symbol;Acc:28660] |
Percent Identity: | 74.73 % |
Parental protein coverage: | 70.54 % |
Number of stop codons detected: | 2 |
Number of frameshifts detected | 0 |
Parental | TRAALTLTPSAVNKIKQLLKDKPEHVGVKVGVRTRGCNGLSYTLEYTKTKGDSDEEVVQDGVRVFIEKKA |
.R......PS.VNKIKQLLKDK.EHVG.KV.V.TRGCNGL.YTLEYTKTKGD.D.EVVQD.VRVFIEK.. | |
Retrocopy | SRSCRLPSPSVVNKIKQLLKDKLEHVGMKVSV*TRGCNGLYYTLEYTKTKGDPD-EVVQDRVRVFIEKEV |
Parental | QLTLLGTEMDYVEDKLSSEFV |
.LT.LGTEMD.VEDK.S.EFV | |
Retrocopy | *LTILGTEMDSVEDKFSNEFV |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Bos taurus | ENSBTAG00000046526 | 2 retrocopies | |
Callithrix jacchus | ENSCJAG00000001940 | 6 retrocopies | |
Cavia porcellus | ENSCPOG00000011872 | 2 retrocopies | |
Dasypus novemcinctus | ENSDNOG00000010652 | 5 retrocopies | |
Echinops telfairi | ENSETEG00000016537 | 1 retrocopy | |
Gorilla gorilla | ENSGGOG00000007518 | 2 retrocopies | |
Microcebus murinus | ENSMICG00000003889 | 1 retrocopy | |
Monodelphis domestica | ENSMODG00000003559 | 1 retrocopy | |
Mus musculus | ENSMUSG00000044792 | 1 retrocopy | |
Otolemur garnettii | ENSOGAG00000015628 | 5 retrocopies | |
Pongo abelii | ENSPPYG00000019339 | 5 retrocopies | |
Rattus norvegicus | ENSRNOG00000018343 | 4 retrocopies | |
Tarsius syrichta | ENSTSYG00000012826 | 2 retrocopies |