RetrogeneDB ID: | retro_ogar_1737 | ||
Retrocopylocation | Organism: | Bushbaby (Otolemur garnettii) | |
Coordinates: | GL873563.1:667774..668190(-) | ||
Located in intron of: | ENSOGAG00000027104 | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | AP3S2 | ||
Ensembl ID: | ENSOGAG00000030982 | ||
Aliases: | None | ||
Description: | adaptor-related protein complex 3, sigma 2 subunit [Source:HGNC Symbol;Acc:571] |
Percent Identity: | 65.73 % |
Parental protein coverage: | 71.5 % |
Number of stop codons detected: | 2 |
Number of frameshifts detected | 4 |
Parental | ILVFNNHGKPRLVRFYQRFPEEI-QQQ-IVRETFHLVLKRDDNICNFLEGGSLIGGSDYKLIYRHYATLY |
..VF.N.GK.RLV.FYQ..PEEI.QQ...VRETFHLVLK.DDNICNF.....LI.GSDYKLIY.HY.TL. | |
Retrocopy | LMVFSNCGKLRLVHFYQKLPEEIQQQM>VVRETFHLVLKQDDNICNFFKSKRLISGSDYKLIY*HYTTLS |
Parental | FVFCVDSSESELGILDLIQV-FVETLDKCFENVCELDLIFHMDKV-HYILQEVVMGGMVLETNMN-EIVA |
.VFCVD.SE..LG.LDLIQV.FVE.LDKCFEN.CEL....HMD.........V..G.MVLETNMN.EI.A | |
Retrocopy | CVFCVDLSENKLGTLDLIQV>FVEILDKCFENMCELGFVVHMDDT<YVL*EVVICG-MVLETNMN>EIIA |
Parental | QIE |
.IE | |
Retrocopy | EIE |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Bos taurus | ENSBTAG00000001407 | 1 retrocopy | |
Choloepus hoffmanni | ENSCHOG00000003359 | 4 retrocopies | |
Dipodomys ordii | ENSDORG00000004247 | 1 retrocopy | |
Equus caballus | ENSECAG00000024044 | 1 retrocopy | |
Felis catus | ENSFCAG00000028122 | 1 retrocopy | |
Macropus eugenii | ENSMEUG00000003421 | 1 retrocopy | |
Monodelphis domestica | ENSMODG00000019522 | 1 retrocopy | |
Nomascus leucogenys | ENSNLEG00000011780 | 2 retrocopies | |
Otolemur garnettii | ENSOGAG00000030982 | 1 retrocopy |
retro_ogar_1737 ,
|
Otolemur garnettii | ENSOGAG00000032376 | 1 retrocopy | |
Rattus norvegicus | ENSRNOG00000043141 | 1 retrocopy | |
Sus scrofa | ENSSSCG00000030174 | 7 retrocopies | |
Tursiops truncatus | ENSTTRG00000015554 | 2 retrocopies | |
Vicugna pacos | ENSVPAG00000008668 | 1 retrocopy |