RetrogeneDB ID: | retro_ecab_549 | ||
Retrocopy location | Organism: | Horse (Equus caballus) | |
| Coordinates: | 20:22675412..22675705(-) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | AP3S2 | ||
| Ensembl ID: | ENSECAG00000024044 | ||
| Aliases: | None | ||
| Description: | adaptor-related protein complex 3, sigma 2 subunit [Source:HGNC Symbol;Acc:571] |
| Percent Identity: | 67.65 % |
| Parental protein coverage: | 50.25 % |
| Number of stop codons detected: | 2 |
| Number of frameshifts detected: | 3 |
| Parental | MIQAILVFNNHGKPRLVRFYQRFPEEI-QQQIVRETFHLVLKRDD-NICNFLEGGSLIGGSDYKLIYRHY |
| .I.AIL.FNNHGK..L..FY....E...QQ.I.RETFHL..KRD..N.CN..EGG.LIGGSD.KL.YRHY | |
| Retrocopy | IIKAILTFNNHGKHQLFKFY*PYSEDT>QQ-IIRETFHLAFKRDE<NVCNSPEGGLLIGGSDNKLTYRHY |
| Parental | ATLYFVFCVDSSESELGILDLIQVFVE-TLDK |
| ..LYFVFCV.SSESELGIL.LI.VF.E.TLDK | |
| Retrocopy | TPLYFVFCVHSSESELGILNLI*VFLE<TLDK |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP021940_articular_cartilage | 0 .00 RPM | 3 .25 RPM |
| SRP021940_cerebellum | 0 .10 RPM | 8 .05 RPM |
| SRP021940_embryo | 0 .00 RPM | 6 .09 RPM |
| SRP021940_placental_villous | 0 .00 RPM | 4 .33 RPM |
| SRP021940_synovial_membrane | 0 .00 RPM | 4 .89 RPM |
| SRP021940_testis | 0 .00 RPM | 9 .14 RPM |
| Species | RetrogeneDB ID |
|---|---|
| Homo sapiens | retro_hsap_3563 |
| Pan troglodytes | retro_ptro_2420 |
| Macaca mulatta | retro_mmul_1821 |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Bos taurus | ENSBTAG00000001407 | 1 retrocopy | |
| Choloepus hoffmanni | ENSCHOG00000003359 | 4 retrocopies | |
| Dipodomys ordii | ENSDORG00000004247 | 1 retrocopy | |
| Equus caballus | ENSECAG00000024044 | 1 retrocopy |
retro_ecab_549 ,
|
| Felis catus | ENSFCAG00000028122 | 1 retrocopy | |
| Macropus eugenii | ENSMEUG00000003421 | 1 retrocopy | |
| Monodelphis domestica | ENSMODG00000019522 | 1 retrocopy | |
| Nomascus leucogenys | ENSNLEG00000011780 | 2 retrocopies | |
| Otolemur garnettii | ENSOGAG00000030982 | 1 retrocopy | |
| Rattus norvegicus | ENSRNOG00000043141 | 1 retrocopy | |
| Sus scrofa | ENSSSCG00000030174 | 7 retrocopies | |
| Tursiops truncatus | ENSTTRG00000015554 | 2 retrocopies | |
| Vicugna pacos | ENSVPAG00000008668 | 1 retrocopy |