RetrogeneDB ID: | retro_ogar_2650 | ||
Retrocopylocation | Organism: | Bushbaby (Otolemur garnettii) | |
Coordinates: | GL873643.1:3276686..3277109(-) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | SRSF10 | ||
Ensembl ID: | ENSOGAG00000015374 | ||
Aliases: | None | ||
Description: | serine/arginine-rich splicing factor 10 [Source:HGNC Symbol;Acc:16713] |
Percent Identity: | 52.48 % |
Parental protein coverage: | 63.23 % |
Number of stop codons detected: | 1 |
Number of frameshifts detected | 0 |
Parental | IEIQFAQGDRKTPNQMKAKEGRNVYSSSRYDDYDRYRRSRSRRFKHRNRSFSRSKSNSRSRSKSQPKKEM |
.E.....G.........A.....V............R...........R...R....SRSRSK..PKKEM | |
Retrocopy | LEV*GRNGEQEVSLLITAIQDLMVLENLLFSSRSSGRPQHTGSHSNNDRVKHRNGFFSRSRSKPKPKKEM |
Parental | KAKSRSRSASHTKTRGTSKTDSKTHYKSGSRYEKESRKKEPPRSKSQSRSQSRSRSKSRSRSWTSPKSSG |
KA.SRSRSA.HTK.RGTSKT.SKT.Y.SG.RYEKESR.KEPPR.K..SRSQ.RSRS.SRSRS.T.PKSSG | |
Retrocopy | KAESRSRSATHTKMRGTSKTNSKTLYNSGWRYEKESRNKEPPRFKPRSRSQGRSRSNSRSRSCTNPKSSG |
Parental | H |
H | |
Retrocopy | H |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Ailuropoda melanoleuca | ENSAMEG00000009869 | 2 retrocopies | |
Bos taurus | ENSBTAG00000008072 | 1 retrocopy | |
Choloepus hoffmanni | ENSCHOG00000004836 | 1 retrocopy | |
Callithrix jacchus | ENSCJAG00000020883 | 9 retrocopies | |
Cavia porcellus | ENSCPOG00000024533 | 1 retrocopy | |
Dasypus novemcinctus | ENSDNOG00000008699 | 3 retrocopies | |
Erinaceus europaeus | ENSEEUG00000014286 | 1 retrocopy | |
Homo sapiens | ENSG00000188529 | 5 retrocopies | |
Gorilla gorilla | ENSGGOG00000000392 | 4 retrocopies | |
Myotis lucifugus | ENSMLUG00000028520 | 1 retrocopy | |
Mustela putorius furo | ENSMPUG00000015845 | 1 retrocopy | |
Nomascus leucogenys | ENSNLEG00000013180 | 3 retrocopies | |
Oryctolagus cuniculus | ENSOCUG00000029326 | 1 retrocopy | |
Otolemur garnettii | ENSOGAG00000015374 | 2 retrocopies |
retro_ogar_2650 , retro_ogar_2987,
|
Pongo abelii | ENSPPYG00000001726 | 4 retrocopies | |
Rattus norvegicus | ENSRNOG00000007992 | 3 retrocopies | |
Ictidomys tridecemlineatus | ENSSTOG00000000956 | 1 retrocopy | |
Tursiops truncatus | ENSTTRG00000016150 | 2 retrocopies |