RetrogeneDB ID: | retro_opri_560 | ||
Retrocopylocation | Organism: | Southern American pika (Ochotona princeps) | |
Coordinates: | scaffold_1720:183159..183383(+) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | None | ||
Ensembl ID: | ENSOPRG00000004130 | ||
Aliases: | None | ||
Description: | None |
Percent Identity: | 51.32 % |
Parental protein coverage: | 66.96 % |
Number of stop codons detected: | 2 |
Number of frameshifts detected | 1 |
Parental | MKLLTHNLLSSHVRGVGPRGFPLRLQATEVRINPVDFNPDFVARMIPKVEW-AALREAAQTLHLVDLPEQ |
MKL..HNLLS.HV..VG.....L.LQA.EV.IN.V.FN......M.P.V.W...L.E.A.TLHL...P.. | |
Retrocopy | MKLPAHNLLSLHV*DVGLCSSLLCLQAMEVHINSVGFNSNLSV*MVPEVVW<VVLWETANTLHLPEVPQE |
Parental | PAEGYE |
P..GYE | |
Retrocopy | PFQGYE |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Ailuropoda melanoleuca | ENSAMEG00000017965 | 3 retrocopies | |
Bos taurus | ENSBTAG00000008646 | 1 retrocopy | |
Callithrix jacchus | ENSCJAG00000018026 | 1 retrocopy | |
Dasypus novemcinctus | ENSDNOG00000004644 | 1 retrocopy | |
Equus caballus | ENSECAG00000016960 | 1 retrocopy | |
Echinops telfairi | ENSETEG00000000263 | 4 retrocopies | |
Homo sapiens | ENSG00000173113 | 4 retrocopies | |
Gorilla gorilla | ENSGGOG00000001334 | 3 retrocopies | |
Macaca mulatta | ENSMMUG00000019647 | 2 retrocopies | |
Ochotona princeps | ENSOPRG00000004130 | 2 retrocopies |
retro_opri_347, retro_opri_560 ,
|
Ictidomys tridecemlineatus | ENSSTOG00000019857 | 1 retrocopy |