RetrogeneDB ID: | retro_pabe_1699 | ||
Retrocopylocation | Organism: | Orangutan (Pongo abelii) | |
Coordinates: | 19_random:3916951..3917305(-) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | PRELID1 | ||
Ensembl ID: | ENSPPYG00000016086 | ||
Aliases: | None | ||
Description: | PRELI domain containing 1 [Source:HGNC Symbol;Acc:30255] |
Percent Identity: | 91.53 % |
Parental protein coverage: | 53.88 % |
Number of stop codons detected: | 0 |
Number of frameshifts detected | 0 |
Parental | MVKYFLGQSVLRSSWDQVFAAFWQRYPNPYSKHVLTEDTVHREVTPDQKLLSRRLLTKTNRMPRWAERLF |
.VKYFLGQS.LRSSWDQVFAAFWQRYPNP.SKHVLTED.VHREVTPDQKLLS.RLLTKTNRMPRWAERLF | |
Retrocopy | VVKYFLGQSLLRSSWDQVFAAFWQRYPNPHSKHVLTEDIVHREVTPDQKLLSQRLLTKTNRMPRWAERLF |
Parental | PANVAHSVYILEDSIVDPQNQTMTTFTWNINHARLMVVEERCVYCVNS |
PANVAHSVYILED.IVDPQNQTMTTF.WNINHARLMVVEERCVYC... | |
Retrocopy | PANVAHSVYILEDTIVDPQNQTMTTFPWNINHARLMVVEERCVYCATT |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP007412_brain_prefrontal_cortex | 0 .00 RPM | 31 .90 RPM |
SRP007412_cerebellum | 0 .00 RPM | 20 .31 RPM |
SRP007412_heart | 0 .00 RPM | 8 .01 RPM |
SRP007412_kidney | 0 .00 RPM | 72 .09 RPM |
SRP007412_liver | 0 .00 RPM | 45 .63 RPM |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Bos taurus | ENSBTAG00000005009 | 2 retrocopies | |
Canis familiaris | ENSCAFG00000016443 | 2 retrocopies | |
Callithrix jacchus | ENSCJAG00000006953 | 5 retrocopies | |
Homo sapiens | ENSG00000169230 | 7 retrocopies | |
Gorilla gorilla | ENSGGOG00000011762 | 3 retrocopies | |
Macropus eugenii | ENSMEUG00000001738 | 12 retrocopies | |
Myotis lucifugus | ENSMLUG00000007008 | 2 retrocopies | |
Macaca mulatta | ENSMMUG00000009046 | 2 retrocopies | |
Monodelphis domestica | ENSMODG00000004804 | 3 retrocopies | |
Mustela putorius furo | ENSMPUG00000012226 | 1 retrocopy | |
Nomascus leucogenys | ENSNLEG00000012714 | 5 retrocopies | |
Otolemur garnettii | ENSOGAG00000011455 | 4 retrocopies | |
Pongo abelii | ENSPPYG00000016086 | 7 retrocopies |
retro_pabe_1283, retro_pabe_1696, retro_pabe_1699 , retro_pabe_2907, retro_pabe_377, retro_pabe_409, retro_pabe_608,
|
Sus scrofa | ENSSSCG00000014042 | 4 retrocopies | |
Tupaia belangeri | ENSTBEG00000006445 | 1 retrocopy | |
Tursiops truncatus | ENSTTRG00000009571 | 1 retrocopy |