RetrogeneDB ID: | retro_pabe_1699 | ||
Retrocopy location | Organism: | Orangutan (Pongo abelii) | |
| Coordinates: | 19_random:3916951..3917305(-) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | PRELID1 | ||
| Ensembl ID: | ENSPPYG00000016086 | ||
| Aliases: | None | ||
| Description: | PRELI domain containing 1 [Source:HGNC Symbol;Acc:30255] |
| Percent Identity: | 91.53 % |
| Parental protein coverage: | 53.88 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected: | 0 |
| Parental | MVKYFLGQSVLRSSWDQVFAAFWQRYPNPYSKHVLTEDTVHREVTPDQKLLSRRLLTKTNRMPRWAERLF |
| .VKYFLGQS.LRSSWDQVFAAFWQRYPNP.SKHVLTED.VHREVTPDQKLLS.RLLTKTNRMPRWAERLF | |
| Retrocopy | VVKYFLGQSLLRSSWDQVFAAFWQRYPNPHSKHVLTEDIVHREVTPDQKLLSQRLLTKTNRMPRWAERLF |
| Parental | PANVAHSVYILEDSIVDPQNQTMTTFTWNINHARLMVVEERCVYCVNS |
| PANVAHSVYILED.IVDPQNQTMTTF.WNINHARLMVVEERCVYC... | |
| Retrocopy | PANVAHSVYILEDTIVDPQNQTMTTFPWNINHARLMVVEERCVYCATT |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP007412_brain_prefrontal_cortex | 0 .00 RPM | 31 .90 RPM |
| SRP007412_cerebellum | 0 .00 RPM | 20 .31 RPM |
| SRP007412_heart | 0 .00 RPM | 8 .01 RPM |
| SRP007412_kidney | 0 .00 RPM | 72 .09 RPM |
| SRP007412_liver | 0 .00 RPM | 45 .63 RPM |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Bos taurus | ENSBTAG00000005009 | 2 retrocopies | |
| Canis familiaris | ENSCAFG00000016443 | 2 retrocopies | |
| Callithrix jacchus | ENSCJAG00000006953 | 5 retrocopies | |
| Homo sapiens | ENSG00000169230 | 7 retrocopies | |
| Gorilla gorilla | ENSGGOG00000011762 | 3 retrocopies | |
| Macropus eugenii | ENSMEUG00000001738 | 12 retrocopies | |
| Myotis lucifugus | ENSMLUG00000007008 | 2 retrocopies | |
| Macaca mulatta | ENSMMUG00000009046 | 2 retrocopies | |
| Monodelphis domestica | ENSMODG00000004804 | 3 retrocopies | |
| Mustela putorius furo | ENSMPUG00000012226 | 1 retrocopy | |
| Nomascus leucogenys | ENSNLEG00000012714 | 5 retrocopies | |
| Otolemur garnettii | ENSOGAG00000011455 | 4 retrocopies | |
| Pongo abelii | ENSPPYG00000016086 | 7 retrocopies |
retro_pabe_1283, retro_pabe_1696, retro_pabe_1699 , retro_pabe_2907, retro_pabe_377, retro_pabe_409, retro_pabe_608,
|
| Sus scrofa | ENSSSCG00000014042 | 4 retrocopies | |
| Tupaia belangeri | ENSTBEG00000006445 | 1 retrocopy | |
| Tursiops truncatus | ENSTTRG00000009571 | 1 retrocopy |