RetrogeneDB ID: | retro_pabe_2409 | ||
Retrocopylocation | Organism: | Orangutan (Pongo abelii) | |
Coordinates: | 3_random:8517308..8517740(+) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | EEF1G | ||
Ensembl ID: | ENSPPYG00000029434 | ||
Aliases: | None | ||
Description: | eukaryotic translation elongation factor 1 gamma [Source:HGNC Symbol;Acc:3213] |
Percent Identity: | 68.24 % |
Parental protein coverage: | 61.44 % |
Number of stop codons detected: | 1 |
Number of frameshifts detected | 3 |
Parental | LADITVVCTLLWLYKQVLEPSFRQ-AFPNTNRWFLTCINQPQFRAVLGEVKLCEKMAQFDAKKFAETQPK |
LADITVVCTLLWLYKQVLEPSF.Q.AF...N.W.LTCINQ.Q..AVL..VKLCEKMAQFDAK.......K | |
Retrocopy | LADITVVCTLLWLYKQVLEPSFHQ<AFLSNNPWLLTCINQTQLWAVLE*VKLCEKMAQFDAKNSTDSPTK |
Parental | KDT-PRKEKGSREEKQKPQAERKEEK-KAAAPAPEEEMDECEQALAAEPKAKDPFAHLPKSTFVLDEFKR |
.DT.P.K..GS..EKQ.PQA..K.EK...A..A.EEEMDECEQALAAEPKAK..FA.L...TFVL.EF.. | |
Retrocopy | NDT<PWKGRGSLKEKQMPQAKQKQEK<NVASLASEEEMDECEQALAAEPKAKGLFAQLLEGTFVLGEFIP |
Parental | KYSNEDTL |
K.S.EDTL | |
Retrocopy | KCSSEDTL |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP007412_brain_prefrontal_cortex | 0 .00 RPM | 205 .63 RPM |
SRP007412_cerebellum | 0 .00 RPM | 127 .19 RPM |
SRP007412_heart | 0 .00 RPM | 351 .76 RPM |
SRP007412_kidney | 0 .00 RPM | 555 .94 RPM |
SRP007412_liver | 0 .00 RPM | 381 .94 RPM |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Ailuropoda melanoleuca | ENSAMEG00000006745 | 1 retrocopy | |
Canis familiaris | ENSCAFG00000015834 | 6 retrocopies | |
Callithrix jacchus | ENSCJAG00000018949 | 6 retrocopies | |
Equus caballus | ENSECAG00000014334 | 1 retrocopy | |
Latimeria chalumnae | ENSLACG00000014700 | 1 retrocopy | |
Loxodonta africana | ENSLAFG00000003339 | 1 retrocopy | |
Monodelphis domestica | ENSMODG00000007691 | 1 retrocopy | |
Mustela putorius furo | ENSMPUG00000013942 | 2 retrocopies | |
Nomascus leucogenys | ENSNLEG00000003528 | 2 retrocopies | |
Oryctolagus cuniculus | ENSOCUG00000020959 | 3 retrocopies | |
Pongo abelii | ENSPPYG00000029434 | 5 retrocopies | |
Pan troglodytes | ENSPTRG00000003768 | 3 retrocopies | |
Rattus norvegicus | ENSRNOG00000020075 | 8 retrocopies |