RetrogeneDB ID: | retro_pabe_3003 | ||
Retrocopy location | Organism: | Orangutan (Pongo abelii) | |
| Coordinates: | 6:129970843..129971172(-) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | CNIH4 | ||
| Ensembl ID: | ENSPPYG00000000183 | ||
| Aliases: | None | ||
| Description: | protein cornichon homolog 4 [Source:RefSeq peptide;Acc:NP_001125902] |
| Percent Identity: | 78.76 % |
| Parental protein coverage: | 80.58 % |
| Number of stop codons detected: | 2 |
| Number of frameshifts detected: | 1 |
| Parental | EAVVFVFSLLDCCALIFLSVYFIITLSDLECDYINARSCCSKLNKWVIPELIGHTIVTVL-LLISLHWFI |
| E..VFVF.LL.C..LIFLSV.FIITLSDLE.DYINARSCCSKLNKWVIP.LIG.TIVTVL...I.LHWFI | |
| Retrocopy | EDMVFVFFLLSC-RLIFLSV-FIITLSDLESDYINARSCCSKLNKWVIPRLIGRTIVTVL<MRILLHWFI |
| Parental | FLLNLPVATWNIYRYIMVPSGNMGVFDPTEIHNRGQLKSHMKE |
| FLLNLP.ATWN.Y..IMVPS.N.GVFDPTEIHN.GQ.K.HMK. | |
| Retrocopy | FLLNLPLATWNTY*FIMVPSSNIGVFDPTEIHNQGQQK*HMKD |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP007412_brain_prefrontal_cortex | 0 .06 RPM | 18 .19 RPM |
| SRP007412_cerebellum | 0 .00 RPM | 22 .01 RPM |
| SRP007412_heart | 0 .00 RPM | 12 .94 RPM |
| SRP007412_kidney | 0 .03 RPM | 21 .11 RPM |
| SRP007412_liver | 0 .00 RPM | 16 .49 RPM |
| Species | RetrogeneDB ID |
|---|---|
| Homo sapiens | retro_hsap_3656 |
| Pan troglodytes | retro_ptro_2481 |
| Macaca mulatta | retro_mmul_1796 |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Choloepus hoffmanni | ENSCHOG00000006544 | 1 retrocopy | |
| Callithrix jacchus | ENSCJAG00000008013 | 1 retrocopy | |
| Cavia porcellus | ENSCPOG00000007310 | 1 retrocopy | |
| Dasypus novemcinctus | ENSDNOG00000007093 | 1 retrocopy | |
| Homo sapiens | ENSG00000143771 | 1 retrocopy | |
| Gorilla gorilla | ENSGGOG00000005708 | 1 retrocopy | |
| Myotis lucifugus | ENSMLUG00000003134 | 1 retrocopy | |
| Macaca mulatta | ENSMMUG00000009936 | 1 retrocopy | |
| Nomascus leucogenys | ENSNLEG00000013549 | 1 retrocopy | |
| Ochotona princeps | ENSOPRG00000001589 | 1 retrocopy | |
| Pongo abelii | ENSPPYG00000000183 | 1 retrocopy |
retro_pabe_3003 ,
|
| Pan troglodytes | ENSPTRG00000002025 | 1 retrocopy | |
| Pteropus vampyrus | ENSPVAG00000014034 | 1 retrocopy | |
| Ictidomys tridecemlineatus | ENSSTOG00000027396 | 2 retrocopies | |
| Vicugna pacos | ENSVPAG00000012521 | 2 retrocopies |