RetrogeneDB ID: | retro_pabe_3148 | ||
Retrocopy location | Organism: | Orangutan (Pongo abelii) | |
| Coordinates: | 7:63903069..63903416(-) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | RALA | ||
| Ensembl ID: | ENSPPYG00000017619 | ||
| Aliases: | None | ||
| Description: | v-ral simian leukemia viral oncogene homolog A (ras related) [Source:HGNC Symbol;Acc:9839] |
| Percent Identity: | 85.71 % |
| Parental protein coverage: | 57.28 % |
| Number of stop codons detected: | 1 |
| Number of frameshifts detected: | 1 |
| Parental | FLCVFSITEMESFAATADFREQI-LRVKEDENVPFLLVGNKSDLEDKRQVSVEEAKNRAEQWNVNYVETS |
| F.CVFSITEMESFAAT.DF.EQI.LRVKEDEN.PFLLVGNKSDLEDKRQVS.EEAKNRA..WNVNYVETS | |
| Retrocopy | FHCVFSITEMESFAATVDFKEQI<LRVKEDENIPFLLVGNKSDLEDKRQVSIEEAKNRAD*WNVNYVETS |
| Parental | AKTRANVDKVFFDLMREIRARKMEDSKEKNGKKKRKSLAKRIRERCCIL |
| AKTRANVDKVFFDLMREIR.RKMED.KE...KKKRKSL...IRER.CIL | |
| Retrocopy | AKTRANVDKVFFDLMREIRVRKMEDDKE--WKKKRKSLTETIRERSCIL |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP007412_brain_prefrontal_cortex | 0 .00 RPM | 15 .20 RPM |
| SRP007412_cerebellum | 0 .00 RPM | 12 .16 RPM |
| SRP007412_heart | 0 .00 RPM | 9 .30 RPM |
| SRP007412_kidney | 0 .00 RPM | 12 .60 RPM |
| SRP007412_liver | 0 .00 RPM | 11 .02 RPM |
| Species | RetrogeneDB ID |
|---|---|
| Homo sapiens | retro_hsap_3707 |
| Pan troglodytes | retro_ptro_2511 |
| Macaca mulatta | retro_mmul_1706 |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Callithrix jacchus | ENSCJAG00000007630 | 1 retrocopy | |
| Dasypus novemcinctus | ENSDNOG00000017413 | 1 retrocopy | |
| Homo sapiens | ENSG00000006451 | 2 retrocopies | |
| Macropus eugenii | ENSMEUG00000000259 | 1 retrocopy | |
| Macaca mulatta | ENSMMUG00000016059 | 2 retrocopies | |
| Nomascus leucogenys | ENSNLEG00000003055 | 1 retrocopy | |
| Pongo abelii | ENSPPYG00000001028 | 1 retrocopy | |
| Pongo abelii | ENSPPYG00000004369 | 1 retrocopy | |
| Pongo abelii | ENSPPYG00000004751 | 1 retrocopy | |
| Pongo abelii | ENSPPYG00000017619 | 3 retrocopies |
retro_pabe_3148 , retro_pabe_3208, retro_pabe_945,
|
| Pan troglodytes | ENSPTRG00000019108 | 1 retrocopy | |
| Sus scrofa | ENSSSCG00000029741 | 1 retrocopy | |
| Ictidomys tridecemlineatus | ENSSTOG00000020292 | 2 retrocopies | |
| Vicugna pacos | ENSVPAG00000002810 | 1 retrocopy |