RetrogeneDB ID: | retro_pabe_343 | ||
Retrocopylocation | Organism: | Orangutan (Pongo abelii) | |
Coordinates: | 1:202191841..202192144(+) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | ARL8B | ||
Ensembl ID: | ENSPPYG00000013694 | ||
Aliases: | None | ||
Description: | ADP-ribosylation factor-like protein 8B [Source:RefSeq peptide;Acc:NP_001126561] |
Percent Identity: | 87.38 % |
Parental protein coverage: | 54.59 % |
Number of stop codons detected: | 1 |
Number of frameshifts detected | 2 |
Parental | KGNVTIKIWDIGGQPRFRSMWERYCRGVNAIVYMIDAADREKIEASRNELHNLLDKPQLQGIPVL-VLGN |
.GNVTIKI.DIGGQ..FRSMWERYCRGV.AIVYMIDAADREKIEASRNELHNLL.KPQLQGIPVL.VLGN | |
Retrocopy | QGNVTIKI*DIGGQAGFRSMWERYCRGVSAIVYMIDAADREKIEASRNELHNLLEKPQLQGIPVL>VLGN |
Parental | KRDL-PNALDEKQLIEKMNLSAIQDREICCYSI |
K.DL..NALDEKQLIEKM.LSAIQDRE.C.YSI | |
Retrocopy | KGDL<SNALDEKQLIEKMSLSAIQDREVCRYSI |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP007412_brain_prefrontal_cortex | 0 .11 RPM | 90 .01 RPM |
SRP007412_cerebellum | 0 .12 RPM | 90 .23 RPM |
SRP007412_heart | 0 .03 RPM | 31 .76 RPM |
SRP007412_kidney | 0 .00 RPM | 36 .13 RPM |
SRP007412_liver | 0 .00 RPM | 25 .34 RPM |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Choloepus hoffmanni | ENSCHOG00000007757 | 2 retrocopies | |
Callithrix jacchus | ENSCJAG00000015842 | 2 retrocopies | |
Homo sapiens | ENSG00000134108 | 1 retrocopy | |
Gallus gallus | ENSGALG00000008314 | 1 retrocopy | |
Gorilla gorilla | ENSGGOG00000004952 | 1 retrocopy | |
Microcebus murinus | ENSMICG00000000244 | 2 retrocopies | |
Mustela putorius furo | ENSMPUG00000017035 | 2 retrocopies | |
Oryctolagus cuniculus | ENSOCUG00000014090 | 2 retrocopies | |
Pongo abelii | ENSPPYG00000000148 | 3 retrocopies | |
Pongo abelii | ENSPPYG00000004473 | 1 retrocopy | |
Pongo abelii | ENSPPYG00000013694 | 1 retrocopy |
retro_pabe_343 ,
|
Pongo abelii | ENSPPYG00000013768 | 3 retrocopies | |
Tarsius syrichta | ENSTSYG00000001724 | 1 retrocopy | |
Vicugna pacos | ENSVPAG00000012114 | 2 retrocopies |