RetrogeneDB ID: | retro_pabe_717 | ||
Retrocopylocation | Organism: | Orangutan (Pongo abelii) | |
Coordinates: | 11:78976937..78977174(+) | ||
Located in intron of: | ENSPPYG00000003735 | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | None | ||
Ensembl ID: | ENSPPYG00000000768 | ||
Aliases: | None | ||
Description: | None |
Percent Identity: | 94.94 % |
Parental protein coverage: | 100. % |
Number of stop codons detected: | 0 |
Number of frameshifts detected | 0 |
Parental | MSHKQIYYSDKYDDEEFEYRHVMLPKDIAKLVPKTHLMSESEWRNLGVQQSQGWVHYMIHEPEPHILLFR |
MSHKQIYYSDKYDDEE.EYRHV.LPKDIAKLV.K.HLMSESEWRNLGVQQSQGWVHYMIHEPEPHILLFR | |
Retrocopy | MSHKQIYYSDKYDDEELEYRHVVLPKDIAKLVRKPHLMSESEWRNLGVQQSQGWVHYMIHEPEPHILLFR |
Parental | RPLPKKPKK |
RPLPKKPKK | |
Retrocopy | RPLPKKPKK |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP007412_brain_prefrontal_cortex | 0 .00 RPM | 5 .81 RPM |
SRP007412_cerebellum | 0 .12 RPM | 1 .58 RPM |
SRP007412_heart | 0 .03 RPM | 5 .54 RPM |
SRP007412_kidney | 0 .00 RPM | 8 .49 RPM |
SRP007412_liver | 0 .03 RPM | 8 .29 RPM |
Species | RetrogeneDB ID |
---|---|
Pan troglodytes | retro_ptro_558 |
Gorilla gorilla | retro_ggor_659 |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Dipodomys ordii | ENSDORG00000003764 | 6 retrocopies | |
Equus caballus | ENSECAG00000003460 | 1 retrocopy | |
Echinops telfairi | ENSETEG00000003337 | 4 retrocopies | |
Felis catus | ENSFCAG00000001347 | 1 retrocopy | |
Homo sapiens | ENSG00000173207 | 1 retrocopy | |
Loxodonta africana | ENSLAFG00000032213 | 1 retrocopy | |
Mus musculus | ENSMUSG00000028044 | 1 retrocopy | |
Nomascus leucogenys | ENSNLEG00000011532 | 3 retrocopies | |
Oryctolagus cuniculus | ENSOCUG00000016204 | 2 retrocopies | |
Otolemur garnettii | ENSOGAG00000006384 | 10 retrocopies | |
Pongo abelii | ENSPPYG00000000768 | 3 retrocopies |
retro_pabe_1143, retro_pabe_3625, retro_pabe_717 ,
|
Pongo abelii | ENSPPYG00000025843 | 1 retrocopy | |
Pan troglodytes | ENSPTRG00000001398 | 4 retrocopies | |
Rattus norvegicus | ENSRNOG00000042561 | 1 retrocopy | |
Sorex araneus | ENSSARG00000012383 | 2 retrocopies | |
Sus scrofa | ENSSSCG00000029737 | 1 retrocopy | |
Vicugna pacos | ENSVPAG00000012182 | 1 retrocopy |