RetrogeneDB ID: | retro_etel_239 | ||
Retrocopylocation | Organism: | Lesser hedgehog tenrec (Echinops telfairi) | |
Coordinates: | GeneScaffold_404:72230..72471(+) | ||
Located in intron of: | ENSETEG00000015342 | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | None | ||
Ensembl ID: | ENSETEG00000003337 | ||
Aliases: | None | ||
Description: | None |
Percent Identity: | 91.46 % |
Parental protein coverage: | 100. % |
Number of stop codons detected: | 0 |
Number of frameshifts detected | 1 |
Parental | MSHKQIYYSDKYDDEEFEYRHVMLPKDIAKLVPKTHLMSESEWRNLGVQQSQGWVHYMIHEP-EP--HIL |
MSHKQIYYSDKYDDEEFEYRHVMLPKDIA.LVPKTHLMSESEWRNLGVQQSQGWVHYM...P.EP..HIL | |
Retrocopy | MSHKQIYYSDKYDDEEFEYRHVMLPKDIAELVPKTHLMSESEWRNLGVQQSQGWVHYM-YDP>EPEPHIL |
Parental | LFRRPLPKKPKK |
LFRRPLPKKPKK | |
Retrocopy | LFRRPLPKKPKK |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Callithrix jacchus | ENSCJAG00000033635 | 10 retrocopies | |
Dipodomys ordii | ENSDORG00000003764 | 6 retrocopies | |
Equus caballus | ENSECAG00000003460 | 1 retrocopy | |
Echinops telfairi | ENSETEG00000001260 | 10 retrocopies | |
Echinops telfairi | ENSETEG00000003337 | 4 retrocopies | |
Felis catus | ENSFCAG00000001347 | 1 retrocopy | |
Homo sapiens | ENSG00000173207 | 1 retrocopy | |
Gorilla gorilla | ENSGGOG00000013419 | 4 retrocopies | |
Loxodonta africana | ENSLAFG00000032213 | 1 retrocopy | |
Mus musculus | ENSMUSG00000028044 | 1 retrocopy | |
Nomascus leucogenys | ENSNLEG00000011532 | 3 retrocopies | |
Oryctolagus cuniculus | ENSOCUG00000016204 | 2 retrocopies | |
Otolemur garnettii | ENSOGAG00000006384 | 10 retrocopies | |
Pongo abelii | ENSPPYG00000000768 | 3 retrocopies | |
Pan troglodytes | ENSPTRG00000001398 | 4 retrocopies | |
Rattus norvegicus | ENSRNOG00000042561 | 1 retrocopy | |
Sorex araneus | ENSSARG00000012383 | 2 retrocopies | |
Sus scrofa | ENSSSCG00000029737 | 1 retrocopy | |
Vicugna pacos | ENSVPAG00000012182 | 1 retrocopy |