RetrogeneDB ID: | retro_ptro_558 | ||
Retrocopylocation | Organism: | Chimpanzee (Pan troglodytes) | |
Coordinates: | 11:81124023..81124260(+) | ||
Located in intron of: | ENSPTRG00000004128 | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | CKS1B | ||
Ensembl ID: | ENSPTRG00000001398 | ||
Aliases: | None | ||
Description: | Pan troglodytes cyclin-dependent kinases regulatory subunit 1 (CKS1B), mRNA. [Source:RefSeq mRNA;Acc:NM_001252546] |
Percent Identity: | 94.94 % |
Parental protein coverage: | 100. % |
Number of stop codons detected: | 0 |
Number of frameshifts detected | 0 |
Parental | MSHKQIYYSDKYDDEEFEYRHVMLPKDIAKLVPKTHLMSESEWRNLGVQQSQGWVHYMIHEPEPHILLFR |
MSHKQIYYSDKYDDEEFEYRHV.LPKDIAKLV.KTHLMSESEWRNLGVQQSQGWV.YMIHEPEPHILLFR | |
Retrocopy | MSHKQIYYSDKYDDEEFEYRHVVLPKDIAKLVRKTHLMSESEWRNLGVQQSQGWVYYMIHEPEPHILLFR |
Parental | RPLPKKPKK |
.PLPKKPKK | |
Retrocopy | CPLPKKPKK |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP007412_brain_prefrontal_cortex | 0 .00 RPM | 3 .65 RPM |
SRP007412_cerebellum | 0 .00 RPM | 3 .23 RPM |
SRP007412_heart | 0 .00 RPM | 4 .23 RPM |
SRP007412_kidney | 0 .03 RPM | 8 .16 RPM |
SRP007412_liver | 0 .00 RPM | 14 .44 RPM |
SRP007412_testis | 0 .00 RPM | 15 .70 RPM |
Species | RetrogeneDB ID |
---|---|
Gorilla gorilla | retro_ggor_659 |
Pongo abelii | retro_pabe_717 |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Dipodomys ordii | ENSDORG00000003764 | 6 retrocopies | |
Equus caballus | ENSECAG00000003460 | 1 retrocopy | |
Echinops telfairi | ENSETEG00000003337 | 4 retrocopies | |
Felis catus | ENSFCAG00000001347 | 1 retrocopy | |
Homo sapiens | ENSG00000173207 | 1 retrocopy | |
Loxodonta africana | ENSLAFG00000032213 | 1 retrocopy | |
Mus musculus | ENSMUSG00000028044 | 1 retrocopy | |
Nomascus leucogenys | ENSNLEG00000011532 | 3 retrocopies | |
Oryctolagus cuniculus | ENSOCUG00000016204 | 2 retrocopies | |
Otolemur garnettii | ENSOGAG00000006384 | 10 retrocopies | |
Pongo abelii | ENSPPYG00000000768 | 3 retrocopies | |
Pan troglodytes | ENSPTRG00000001398 | 4 retrocopies | |
Pan troglodytes | ENSPTRG00000021093 | 1 retrocopy | |
Rattus norvegicus | ENSRNOG00000042561 | 1 retrocopy | |
Sorex araneus | ENSSARG00000012383 | 2 retrocopies | |
Sus scrofa | ENSSSCG00000029737 | 1 retrocopy | |
Vicugna pacos | ENSVPAG00000012182 | 1 retrocopy |