RetrogeneDB ID: | retro_ptro_137 | ||
Retrocopylocation | Organism: | Chimpanzee (Pan troglodytes) | |
Coordinates: | 1:27746521..27746737(+) | ||
Located in intron of: | ENSPTRG00000000414 | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | TXNDC17 | ||
Ensembl ID: | ENSPTRG00000008644 | ||
Aliases: | TXNDC17, TXNL5 | ||
Description: | None |
Percent Identity: | 83.33 % |
Parental protein coverage: | 58.54 % |
Number of stop codons detected: | 1 |
Number of frameshifts detected | 0 |
Parental | VVREGLKHISEGCVFIYCQVGEKPYWKDPNNDFRKNLKVTAVPTLLKYGTPQKLVESECLQANLVEMLFS |
....GLKH.SEGCVF.YCQV.EKPYWKDPNNDFRKNL.VT.VPTLLKYGTPQKLVES.CLQANLVEM.FS | |
Retrocopy | MLNQGLKHVSEGCVFAYCQVEEKPYWKDPNNDFRKNLEVTTVPTLLKYGTPQKLVES*CLQANLVEMFFS |
Parental | ED |
.D | |
Retrocopy | KD |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP007412_brain_prefrontal_cortex | 0 .05 RPM | 10 .55 RPM |
SRP007412_cerebellum | 0 .00 RPM | 4 .48 RPM |
SRP007412_heart | 0 .03 RPM | 5 .54 RPM |
SRP007412_kidney | 0 .03 RPM | 41 .14 RPM |
SRP007412_liver | 0 .03 RPM | 25 .37 RPM |
SRP007412_testis | 0 .00 RPM | 11 .70 RPM |
Species | RetrogeneDB ID |
---|---|
Homo sapiens | retro_hsap_132 |
Gorilla gorilla | retro_ggor_230 |
Pongo abelii | retro_pabe_485 |
Macaca mulatta | retro_mmul_365 |
Callithrix jacchus | retro_cjac_2887 |