RetrogeneDB ID: | retro_ptro_1521 | ||
Retrocopylocation | Organism: | Chimpanzee (Pan troglodytes) | |
Coordinates: | 22:43273865..43274089(-) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | MRPS18C | ||
Ensembl ID: | ENSPTRG00000016233 | ||
Aliases: | None | ||
Description: | mitochondrial ribosomal protein S18C [Source:HGNC Symbol;Acc:16633] |
Percent Identity: | 85.53 % |
Parental protein coverage: | 52.82 % |
Number of stop codons detected: | 0 |
Number of frameshifts detected | 1 |
Parental | CILCGKHVDYKNVQLLSQFVSPFTGCIYGRHITGLCGKKQKEITKAIKRAQIMGFMPVTYKD-PAYLKDP |
C.LCGK.VD.KNVQLLS.F.S.FTG.IYGR.I.GLCGKKQKEITKAIKRAQIMGFMPVTYKD..AYLKDP | |
Retrocopy | CVLCGKRVDDKNVQLLSHFISAFTGGIYGRYIIGLCGKKQKEITKAIKRAQIMGFMPVTYKD<SAYLKDP |
Parental | KVCNIR |
KVCNIR | |
Retrocopy | KVCNIR |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP007412_brain_prefrontal_cortex | 0 .00 RPM | 7 .35 RPM |
SRP007412_cerebellum | 0 .00 RPM | 6 .13 RPM |
SRP007412_heart | 0 .00 RPM | 9 .91 RPM |
SRP007412_kidney | 0 .03 RPM | 10 .46 RPM |
SRP007412_liver | 0 .00 RPM | 9 .39 RPM |
SRP007412_testis | 0 .63 RPM | 7 .38 RPM |
Species | RetrogeneDB ID |
---|---|
Homo sapiens | retro_hsap_2597 |
Macaca mulatta | retro_mmul_655 |