RetrogeneDB ID: | retro_mmus_2127 | ||
Retrocopy location | Organism: | Mouse (Mus musculus) | |
| Coordinates: | 2:168242125..168242359(-) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | ENSMUSG00000083342 | |
| Aliases: | None | ||
| Status: | KNOWN_PSEUDOGENE | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | Mrps18c | ||
| Ensembl ID: | ENSMUSG00000016833 | ||
| Aliases: | None | ||
| Description: | mitochondrial ribosomal protein S18C [Source:MGI Symbol;Acc:MGI:1915985] |
| Percent Identity: | 80.77 % |
| Parental protein coverage: | 60.94 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected: | 0 |
| Parental | GTQAVSVIWRRCFSQFEQVTSNEDLPVPMENPYKEPLKKCVLCEKRVDYKNVQLLSQFISPFTGCIYGRH |
| GT...SV.WRR.F.Q.E.VTSNEDLP.PMENPYKEPL.KCVLCEKRVDYK.VQL.SQFISPFTGC.YGR. | |
| Retrocopy | GTHEASVLWRRSFTQSELVTSNEDLPIPMENPYKEPLGKCVLCEKRVDYKSVQLWSQFISPFTGCSYGRL |
| Parental | ITGLCGKK |
| ITGLC.KK | |
| Retrocopy | ITGLCVKK |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP007412_brain | 0 .02 RPM | 11 .28 RPM |
| SRP007412_cerebellum | 0 .00 RPM | 7 .95 RPM |
| SRP007412_heart | 0 .00 RPM | 12 .30 RPM |
| SRP007412_kidney | 0 .00 RPM | 18 .42 RPM |
| SRP007412_liver | 0 .00 RPM | 15 .02 RPM |
| SRP007412_testis | 0 .00 RPM | 17 .29 RPM |