RetrogeneDB ID: | retro_mmul_655 | ||
Retrocopy location | Organism: | Rhesus macaque (Macaca mulatta) | |
| Coordinates: | 10:88482282..88482501(-) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | MRPS18C | ||
| Ensembl ID: | ENSMMUG00000015353 | ||
| Aliases: | None | ||
| Description: | 28S ribosomal protein S18c, mitochondrial [Source:RefSeq peptide;Acc:NP_001253055] |
| Percent Identity: | 71.43 % |
| Parental protein coverage: | 52.08 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected: | 2 |
| Parental | CILCGKRVDYKNVQLLSQFVSPFTGCIYGRHITGLCG-KKQKEITKAIKRAQILGFMPVTYKD-PAYLKD |
| CILCGK.VD.KN.QLLS.F.SPFTGCIYGR.ITGLCG....K......KRAQI.GFMP.TY.D..AYLKD | |
| Retrocopy | CILCGKHVDDKNIQLLSHFISPFTGCIYGRYITGLCG>RNRKKLQN--KRAQIMGFMPATYED<SAYLKD |
| Parental | PKVCNIR |
| PKV.NIR | |
| Retrocopy | PKVSNIR |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP007412_brain | 0 .22 RPM | 11 .21 RPM |
| SRP007412_brain_prefrontal_cortex | 0 .00 RPM | 6 .03 RPM |
| SRP007412_cerebellum | 0 .00 RPM | 10 .98 RPM |
| SRP007412_heart | 0 .00 RPM | 10 .72 RPM |
| SRP007412_kidney | 0 .00 RPM | 13 .15 RPM |
| SRP007412_liver | 0 .00 RPM | 10 .33 RPM |
| SRP007412_testis | 0 .00 RPM | 13 .76 RPM |
| Species | RetrogeneDB ID |
|---|---|
| Homo sapiens | retro_hsap_2597 |
| Pan troglodytes | retro_ptro_1521 |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Bos taurus | ENSBTAG00000018155 | 3 retrocopies | |
| Callithrix jacchus | ENSCJAG00000005286 | 3 retrocopies | |
| Cavia porcellus | ENSCPOG00000009198 | 1 retrocopy | |
| Dasypus novemcinctus | ENSDNOG00000018326 | 2 retrocopies | |
| Macropus eugenii | ENSMEUG00000010972 | 2 retrocopies | |
| Myotis lucifugus | ENSMLUG00000017057 | 1 retrocopy | |
| Macaca mulatta | ENSMMUG00000015353 | 4 retrocopies | |
| Mus musculus | ENSMUSG00000016833 | 2 retrocopies | |
| Nomascus leucogenys | ENSNLEG00000009119 | 4 retrocopies | |
| Ochotona princeps | ENSOPRG00000004113 | 2 retrocopies | |
| Pongo abelii | ENSPPYG00000025867 | 2 retrocopies | |
| Pteropus vampyrus | ENSPVAG00000006439 | 2 retrocopies | |
| Rattus norvegicus | ENSRNOG00000002178 | 3 retrocopies | |
| Sarcophilus harrisii | ENSSHAG00000007084 | 1 retrocopy | |
| Ictidomys tridecemlineatus | ENSSTOG00000007989 | 1 retrocopy | |
| Tupaia belangeri | ENSTBEG00000012505 | 3 retrocopies | |
| Tarsius syrichta | ENSTSYG00000012924 | 1 retrocopy | |
| Tursiops truncatus | ENSTTRG00000004897 | 2 retrocopies |