RetrogeneDB ID: | retro_cpor_178 | ||
Retrocopy location | Organism: | Guinea Pig (Cavia porcellus) | |
| Coordinates: | scaffold_1:48402480..48402683(+) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | MRPS18C | ||
| Ensembl ID: | ENSCPOG00000009198 | ||
| Aliases: | None | ||
| Description: | None |
| Percent Identity: | 52.7 % |
| Parental protein coverage: | 50.69 % |
| Number of stop codons detected: | 1 |
| Number of frameshifts detected: | 1 |
| Parental | TMENPYKEPLKKCILCGKRVDYKNVQLLSQFISAYTGCIHGRHITGLCGKKQKEISKAIKRAQ-VMGFMP |
| ..E.P.......C......V.YK.VQLLSQF.S.YTGC.HGRHITGL........SKAIKRA...MG.MP | |
| Retrocopy | SLEGPFXXXXASCVA---NVEYKPVQLLSQFMSSYTGCVHGRHITGL--*EETKVSKAIKRAR<IMGLMP |
| Parental | VTHK |
| V..K | |
| Retrocopy | VIYK |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP017611_brain | 0 .40 RPM | 17 .08 RPM |
| SRP017611_kidney | 0 .21 RPM | 12 .25 RPM |
| SRP017611_liver | 0 .22 RPM | 16 .10 RPM |
| SRP040447_lung | 0 .23 RPM | 9 .99 RPM |
| SRP040447_skeletal_muscle | 0 .31 RPM | 12 .60 RPM |