RetrogeneDB ID: | retro_ptro_2286 | ||
Retrocopylocation | Organism: | Chimpanzee (Pan troglodytes) | |
Coordinates: | 5:110312572..110313004(-) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | PGAM5 | ||
Ensembl ID: | ENSPTRG00000005657 | ||
Aliases: | None | ||
Description: | Phosphoglycerate mutase family member 5 [Source:UniProtKB/TrEMBL;Acc:K7DH40] |
Percent Identity: | 68.28 % |
Parental protein coverage: | 51.6 % |
Number of stop codons detected: | 0 |
Number of frameshifts detected | 0 |
Parental | AGGDAEPRPAEPPAWAGGARPGPGVWDPNWDRREPLSLINVRKRNVESGEEELASKLDHYKAKATRHIFL |
AG....PR.AEP.AWA.G.RP...VWDP..DR.EPLSL.N.RKRNVESGEE.LAS.LDH...KAT.H..L | |
Retrocopy | AGTVGKPRAAEPRAWAWGTRPSLSVWDPDRDRQEPLSLNNLRKRNVESGEE-LASRLDHCRVKATGHTLL |
Parental | IRHSQYHVDGSLEKDRTLTPLGREQAELTGLRLASLGLKFNKIVHSSMTRAIETTDIISRHLPGVCKVST |
...SQYHVDGSLEKD..L.P.GREQ.ELTGLRLASLGL.FNKIVHSSMT...ETT....RH.P.V.K..T | |
Retrocopy | VMRSQYHVDGSLEKDCSLNPPGREQVELTGLRLASLGLRFNKIVHSSMTHPTETTGFSNRHPPRVFKGRT |
Parental | DLLRE |
DL.RE | |
Retrocopy | DLGRE |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP007412_brain_prefrontal_cortex | 0 .00 RPM | 12 .91 RPM |
SRP007412_cerebellum | 0 .00 RPM | 13 .87 RPM |
SRP007412_heart | 0 .00 RPM | 7 .17 RPM |
SRP007412_kidney | 0 .00 RPM | 12 .92 RPM |
SRP007412_liver | 0 .03 RPM | 17 .19 RPM |
SRP007412_testis | 2 .85 RPM | 12 .22 RPM |
Species | RetrogeneDB ID |
---|---|
Homo sapiens | retro_hsap_3363 |
Macaca mulatta | retro_mmul_2101 |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Ailuropoda melanoleuca | ENSAMEG00000013437 | 2 retrocopies | |
Choloepus hoffmanni | ENSCHOG00000011867 | 2 retrocopies | |
Felis catus | ENSFCAG00000002503 | 2 retrocopies | |
Homo sapiens | ENSG00000247077 | 1 retrocopy | |
Myotis lucifugus | ENSMLUG00000013646 | 1 retrocopy | |
Macaca mulatta | ENSMMUG00000015466 | 1 retrocopy | |
Mustela putorius furo | ENSMPUG00000002639 | 1 retrocopy | |
Pan troglodytes | ENSPTRG00000005657 | 1 retrocopy |
retro_ptro_2286 ,
|
Rattus norvegicus | ENSRNOG00000037443 | 1 retrocopy | |
Sus scrofa | ENSSSCG00000026764 | 1 retrocopy | |
Tursiops truncatus | ENSTTRG00000010653 | 1 retrocopy |