RetrogeneDB ID: | retro_ptro_2307 | ||
Retrocopylocation | Organism: | Chimpanzee (Pan troglodytes) | |
Coordinates: | 5:158819571..158819912(-) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | RPLP2 | ||
Ensembl ID: | ENSPTRG00000003137 | ||
Aliases: | None | ||
Description: | ribosomal protein, large, P2 [Source:HGNC Symbol;Acc:10377] |
Percent Identity: | 83.62 % |
Parental protein coverage: | 100. % |
Number of stop codons detected: | 1 |
Number of frameshifts detected | 1 |
Parental | MRYVASYLLAALGGNSSPSAKDIKKILDSVGIEADDDRLNKVISELNGKNIEDVIAQGIGKLASVPAGGA |
MRY.ASYLLAALGGN..PS.KDIKKILDSVGIE.D.DRLNKVIS.LNGKNIED.IA..I.KLA.VPAGGA | |
Retrocopy | MRYIASYLLAALGGNPYPSDKDIKKILDSVGIETDNDRLNKVISGLNGKNIEDIIAKSISKLANVPAGGA |
Parental | VAVSAAPGSAAPAAGSAPA-AAEEKKDEKKEESEESDDDMGFGLFD |
VAVSAAPGSAAPAAGS.P..AA.EKKDE.KEESEE..DDMGFGLFD | |
Retrocopy | VAVSAAPGSAAPAAGSTPS<AAAEKKDE-KEESEE*NDDMGFGLFD |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP007412_brain_prefrontal_cortex | 0 .00 RPM | 116 .51 RPM |
SRP007412_cerebellum | 0 .00 RPM | 52 .77 RPM |
SRP007412_heart | 0 .00 RPM | 49 .05 RPM |
SRP007412_kidney | 0 .00 RPM | 175 .71 RPM |
SRP007412_liver | 0 .00 RPM | 152 .80 RPM |
SRP007412_testis | 0 .00 RPM | 26 .77 RPM |
Species | RetrogeneDB ID |
---|---|
Homo sapiens | retro_hsap_3395 |
Gorilla gorilla | retro_ggor_2298 |
Pongo abelii | retro_pabe_2789 |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Bos taurus | ENSBTAG00000001777 | 2 retrocopies | |
Canis familiaris | ENSCAFG00000009523 | 1 retrocopy | |
Ciona intestinalis | ENSCING00000000626 | 1 retrocopy | |
Dipodomys ordii | ENSDORG00000016458 | 3 retrocopies | |
Felis catus | ENSFCAG00000008417 | 1 retrocopy | |
Homo sapiens | ENSG00000177600 | 5 retrocopies | |
Gorilla gorilla | ENSGGOG00000010789 | 5 retrocopies | |
Mus musculus | ENSMUSG00000025508 | 4 retrocopies | |
Nomascus leucogenys | ENSNLEG00000026860 | 5 retrocopies | |
Otolemur garnettii | ENSOGAG00000016296 | 2 retrocopies | |
Pongo abelii | ENSPPYG00000002885 | 6 retrocopies | |
Pan troglodytes | ENSPTRG00000003137 | 5 retrocopies | |
Rattus norvegicus | ENSRNOG00000002116 | 3 retrocopies | |
Sarcophilus harrisii | ENSSHAG00000001056 | 1 retrocopy | |
Sus scrofa | ENSSSCG00000012842 | 1 retrocopy |