RetrogeneDB ID: | retro_pabe_2844 | ||
Retrocopy location | Organism: | Orangutan (Pongo abelii) | |
| Coordinates: | 6:28833873..28834177(+) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | RPLP2 | ||
| Ensembl ID: | ENSPPYG00000002885 | ||
| Aliases: | None | ||
| Description: | ribosomal protein, large, P2 [Source:HGNC Symbol;Acc:10377] |
| Percent Identity: | 71.57 % |
| Parental protein coverage: | 87.83 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected: | 1 |
| Parental | MRYVASYLLAALGGNSSPSAKDIKKILDSVGIEADDDRLNKVISELNGKNIEDVIAQGIGKLASVPAGGA |
| M.Y..SYLL..L..N.S.SA.DIKKILD.VG.EA.DD.LNKVISELNGKNIE..IAQGIG.LASVPAGGA | |
| Retrocopy | MLYLTSYLLPSLVSNTSLSARDIKKILDRVGMEATDDWLNKVISELNGKNIEGIIAQGIGELASVPAGGA |
| Parental | VAVSAAPGSAAPAAGSAPAAVE-EKKDEKKEE |
| VA.SA..GSAAPAAGS.PAA.E...K.E...E | |
| Retrocopy | VAISASLGSAAPAAGSTPAAEE>DEKKEESSE |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |
| Library | Retrocopy expression | Parental gene expression |
|---|---|---|
| SRP007412_brain_prefrontal_cortex | 0 .00 RPM | 54 .30 RPM |
| SRP007412_cerebellum | 0 .00 RPM | 26 .51 RPM |
| SRP007412_heart | 0 .00 RPM | 33 .99 RPM |
| SRP007412_kidney | 0 .00 RPM | 98 .84 RPM |
| SRP007412_liver | 0 .00 RPM | 85 .23 RPM |
| Species | RetrogeneDB ID |
|---|---|
| Homo sapiens | retro_hsap_3440 |
| Pan troglodytes | retro_ptro_2332 |
| Gorilla gorilla | retro_ggor_2323 |
| Callithrix jacchus | retro_cjac_2399 |
| Species | Parental gene accession | Retrocopies number | |
|---|---|---|---|
| Bos taurus | ENSBTAG00000001777 | 2 retrocopies | |
| Canis familiaris | ENSCAFG00000009523 | 1 retrocopy | |
| Ciona intestinalis | ENSCING00000000626 | 1 retrocopy | |
| Dipodomys ordii | ENSDORG00000016458 | 3 retrocopies | |
| Felis catus | ENSFCAG00000008417 | 1 retrocopy | |
| Homo sapiens | ENSG00000177600 | 5 retrocopies | |
| Gorilla gorilla | ENSGGOG00000010789 | 5 retrocopies | |
| Mus musculus | ENSMUSG00000025508 | 4 retrocopies | |
| Nomascus leucogenys | ENSNLEG00000026860 | 5 retrocopies | |
| Otolemur garnettii | ENSOGAG00000016296 | 2 retrocopies | |
| Pongo abelii | ENSPPYG00000002885 | 6 retrocopies |
retro_pabe_1537, retro_pabe_1543, retro_pabe_2789, retro_pabe_2844 , retro_pabe_732, retro_pabe_830,
|
| Pan troglodytes | ENSPTRG00000003137 | 5 retrocopies | |
| Rattus norvegicus | ENSRNOG00000002116 | 3 retrocopies | |
| Sarcophilus harrisii | ENSSHAG00000001056 | 1 retrocopy | |
| Sus scrofa | ENSSSCG00000012842 | 1 retrocopy |