RetrogeneDB ID: | retro_ptro_2555 | ||
Retrocopylocation | Organism: | Chimpanzee (Pan troglodytes) | |
Coordinates: | 7:106735986..106736302(+) | ||
Located in intron of: | ENSPTRG00000019564 | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | RPL36 | ||
Ensembl ID: | ENSPTRG00000010338 | ||
Aliases: | None | ||
Description: | Pan troglodytes ribosomal protein L36 (RPL36), mRNA. [Source:RefSeq mRNA;Acc:NM_001252514] |
Percent Identity: | 86.79 % |
Parental protein coverage: | 100. % |
Number of stop codons detected: | 0 |
Number of frameshifts detected | 1 |
Parental | MALRYPMAVGLNKGHKVTKNVSKPRHSRRRGRLTKHTKFVRDMIREVCGFAPYERRAMELL-KVSKDKRA |
.ALRYPMAVGLNKG.KVTKNVS.PRHSRRRGRLTKHTKFVRDMI.E.CGFAPY...A.ELL.KVSKDKR. | |
Retrocopy | LALRYPMAVGLNKGQKVTKNVSEPRHSRRRGRLTKHTKFVRDMIPEACGFAPYKQHAKELL>KVSKDKRV |
Parental | LKFIKKRVGTHIRAKRKREELSNVLAAMRKAAAKKD |
LKFIKKRV..HIRAKRKREE.SNVLAAMRKAAAKKD | |
Retrocopy | LKFIKKRVWAHIRAKRKREEQSNVLAAMRKAAAKKD |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP007412_brain_prefrontal_cortex | 0 .05 RPM | 127 .02 RPM |
SRP007412_cerebellum | 0 .00 RPM | 50 .22 RPM |
SRP007412_heart | 0 .00 RPM | 23 .58 RPM |
SRP007412_kidney | 0 .03 RPM | 157 .46 RPM |
SRP007412_liver | 0 .00 RPM | 102 .95 RPM |
SRP007412_testis | 0 .11 RPM | 7 .59 RPM |
Species | RetrogeneDB ID |
---|---|
Homo sapiens | retro_hsap_3769 |
Gorilla gorilla | retro_ggor_2535 |
Pongo abelii | retro_pabe_3081 |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Ailuropoda melanoleuca | ENSAMEG00000012349 | 6 retrocopies | |
Bos taurus | ENSBTAG00000001794 | 3 retrocopies | |
Callithrix jacchus | ENSCJAG00000017072 | 2 retrocopies | |
Dasypus novemcinctus | ENSDNOG00000005163 | 8 retrocopies | |
Gorilla gorilla | ENSGGOG00000015365 | 11 retrocopies | |
Latimeria chalumnae | ENSLACG00000015161 | 1 retrocopy | |
Macropus eugenii | ENSMEUG00000002743 | 4 retrocopies | |
Monodelphis domestica | ENSMODG00000001275 | 2 retrocopies | |
Mustela putorius furo | ENSMPUG00000006166 | 6 retrocopies | |
Mus musculus | ENSMUSG00000057863 | 9 retrocopies | |
Nomascus leucogenys | ENSNLEG00000013689 | 15 retrocopies | |
Otolemur garnettii | ENSOGAG00000027049 | 12 retrocopies | |
Pan troglodytes | ENSPTRG00000010338 | 13 retrocopies | |
Rattus norvegicus | ENSRNOG00000033473 | 5 retrocopies | |
Sarcophilus harrisii | ENSSHAG00000013492 | 8 retrocopies | |
Ictidomys tridecemlineatus | ENSSTOG00000020518 | 2 retrocopies |