RetrogeneDB ID: | retro_ptro_258 | ||
Retrocopylocation | Organism: | Chimpanzee (Pan troglodytes) | |
Coordinates: | 1:212059218..212059790(+) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | C9orf78 | ||
Ensembl ID: | ENSPTRG00000021465 | ||
Aliases: | None | ||
Description: | chromosome 9 open reading frame 78 [Source:HGNC Symbol;Acc:24932] |
Percent Identity: | 54.27 % |
Parental protein coverage: | 67.82 % |
Number of stop codons detected: | 3 |
Number of frameshifts detected | 3 |
Parental | EEDEQDSEEVRLKLEETREVQNLRKR-PNGVSAVALLVGEKVQEETTLVDDPFQMKTGGMVDMKKLKERG |
.EDEQD.EE...KL.ET.EVQ.LRK.....V.AVAL..GE..Q.E.TLV.D..Q.KT.G...M....E.G | |
Retrocopy | QEDEQD*EEI*FKLKETGEVQDLRKK<TRHVRAVALQMGEGIQVEATLVGDFLQIKT-GSMYMGQ-EEKG |
Parental | KDKISEEEDLHLGTSFSAETNRRDEDADMMKYIETELKKRKGIVEH-EEQKVKPKNAEDCLYELPENIRV |
.D.IS.EEDL....SFS.ETN...E....MKY.ET..K.RKG...H..EQK.K.K.AEDCLYEL.EN... | |
Retrocopy | MDGISKEEDLQPRMSFSEETNPG*EGMSVMKYMETKTKQRKGLLDH<QEQKIKLKSAEDCLYELSENTCL |
Parental | -SSAKKTEEMLSNQMLSGIPEVDLGIDAKIKNIISTEDAKARLLAEQQNKKKDSETSFV |
.SS.K...EML..Q.....P.VD...DA.I...I.T..AKA.LLAE.QNKKKD.ETS.V | |
Retrocopy | >SSKK-AKEMLPTQCWVH-PKVDVCTDAEIE-CIATKEAKAWLLAEDQNKKKDIETSCV |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP007412_brain_prefrontal_cortex | 0 .00 RPM | 39 .65 RPM |
SRP007412_cerebellum | 0 .00 RPM | 76 .32 RPM |
SRP007412_heart | 0 .09 RPM | 39 .43 RPM |
SRP007412_kidney | 0 .00 RPM | 46 .29 RPM |
SRP007412_liver | 0 .00 RPM | 37 .58 RPM |
SRP007412_testis | 0 .63 RPM | 106 .33 RPM |
Species | RetrogeneDB ID |
---|---|
Homo sapiens | retro_hsap_320 |
Callithrix jacchus | retro_cjac_1757 |
Bos taurus | retro_btau_1138 |
Equus caballus | retro_ecab_174 |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Canis familiaris | ENSCAFG00000019979 | 1 retrocopy | |
Choloepus hoffmanni | ENSCHOG00000013895 | 3 retrocopies | |
Callithrix jacchus | ENSCJAG00000020318 | 3 retrocopies | |
Dasypus novemcinctus | ENSDNOG00000019214 | 1 retrocopy | |
Homo sapiens | ENSG00000136819 | 3 retrocopies | |
Gorilla gorilla | ENSGGOG00000013358 | 1 retrocopy | |
Macropus eugenii | ENSMEUG00000010524 | 3 retrocopies | |
Macaca mulatta | ENSMMUG00000003795 | 2 retrocopies | |
Monodelphis domestica | ENSMODG00000006832 | 1 retrocopy | |
Nomascus leucogenys | ENSNLEG00000017658 | 3 retrocopies | |
Otolemur garnettii | ENSOGAG00000009770 | 1 retrocopy | |
Pongo abelii | ENSPPYG00000019685 | 1 retrocopy | |
Pan troglodytes | ENSPTRG00000021465 | 3 retrocopies |
retro_ptro_1943, retro_ptro_1969, retro_ptro_258 ,
|
Sarcophilus harrisii | ENSSHAG00000012313 | 1 retrocopy |