RetrogeneDB ID: | retro_ptro_311 | ||
Retrocopylocation | Organism: | Chimpanzee (Pan troglodytes) | |
Coordinates: | 1:71995737..71996005(-) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | COX6A1 | ||
Ensembl ID: | ENSPTRG00000005532 | ||
Aliases: | None | ||
Description: | cytochrome c oxidase subunit VIa polypeptide 1 [Source:HGNC Symbol;Acc:2277] |
Percent Identity: | 51.06 % |
Parental protein coverage: | 84.4 % |
Number of stop codons detected: | 1 |
Number of frameshifts detected | 2 |
Parental | PQLGRPMSSGAHGEEGSARMWKTLTFFVALPGVAVSMLNVYLKSHHGEHERPEFIAYPHLRIRTKPFPWG |
P.L..PMSS......GSA...K.L..F...P.V.V......LKSHH.EHE.P.FIA......R..PFP.G | |
Retrocopy | PPLIKPMSSVPRVTQGSACV*KALVYFAKFPMVGVNTPSAFLKSHHKEHEMPKFIAISTSGLR--PFPTG |
Parental | -DGNHTLFHN-PHVNPLPTGYEDE |
.DGNHTLF.N.P..N.LP.GY.DE | |
Retrocopy | <DGNHTLFYN<PSMNLLPIGYDDE |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP007412_brain_prefrontal_cortex | 0 .00 RPM | 186 .88 RPM |
SRP007412_cerebellum | 0 .04 RPM | 75 .78 RPM |
SRP007412_heart | 0 .00 RPM | 15 .24 RPM |
SRP007412_kidney | 0 .00 RPM | 144 .67 RPM |
SRP007412_liver | 0 .00 RPM | 116 .44 RPM |
SRP007412_testis | 0 .11 RPM | 38 .25 RPM |
Species | RetrogeneDB ID |
---|---|
Equus caballus | retro_ecab_845 |