RetrogeneDB ID: | retro_mluc_465 | ||
Retrocopy location | Organism: | Microbat (Myotis lucifugus) | |
| Coordinates: | AAPE02067356:3915..4146(-) | ||
| Located in intron of: | None | ||
Retrocopy information | Ensembl ID: | None | |
| Aliases: | None | ||
| Status: | NOVEL | ||
Parental gene information | Parental gene summary: | ||
| Parental gene symbol: | None | ||
| Ensembl ID: | ENSMLUG00000010330 | ||
| Aliases: | None | ||
| Description: | Cytochrome c oxidase subunit 6A, mitochondrial [Source:UniProtKB/TrEMBL;Acc:G1PFM9] |
| Percent Identity: | 56.1 % |
| Parental protein coverage: | 71.82 % |
| Number of stop codons detected: | 0 |
| Number of frameshifts detected: | 3 |
| Parental | RLRPQLARPMSSGAHGEEGSARLWKS-LTYFVALPGVAVSMLNVFLKSR-HGEHERPEFVAYP-HLRIRT |
| ..R....RP...G....EG.AR.WK......VALPGV.VS.L..FL.S..HG.HERPEFVAYP.HL..R. | |
| Retrocopy | KVRSLSSRPNFPGSW-REGTARIWKA<FNDHVALPGVGVSLLTIFLESY<HGKHERPEFVAYP<HLCTRP |
| Parental | KPFPWGDGNHTL |
| ..FPWG.GNHTL | |
| Retrocopy | TTFPWGGGNHTL |
| * | Stop codon |
| > | Forward frameshift by one nucleotide |
| < | Reverse frameshift by one nucleotide |