RetrogeneDB ID: | retro_ptro_3153 | ||
Retrocopylocation | Organism: | Chimpanzee (Pan troglodytes) | |
Coordinates: | X:110974521..110974932(+) | ||
Located in intron of: | None | ||
Retrocopyinformation | Ensembl ID: | None | |
Aliases: | None | ||
Status: | NOVEL | ||
Parental geneinformation | Parental gene summary: | ||
Parental gene symbol: | TDGF1 | ||
Ensembl ID: | ENSPTRG00000014854 | ||
Aliases: | None | ||
Description: | teratocarcinoma-derived growth factor 1 [Source:HGNC Symbol;Acc:11701] |
Percent Identity: | 97.81 % |
Parental protein coverage: | 72.87 % |
Number of stop codons detected: | 0 |
Number of frameshifts detected | 0 |
Parental | WPQEEPAIRPRSSQRVPPMGIQHSKELNRTCCLNGGTCMLGSFCACPPSFYGRNCEHDVRKENCGSVPHD |
WPQEEPAIRPRSSQRVPPMGIQHSKELNRTCCLNGGTCML.SFCACPPSFYGRNCEHDVRKENCGSVPHD | |
Retrocopy | WPQEEPAIRPRSSQRVPPMGIQHSKELNRTCCLNGGTCMLESFCACPPSFYGRNCEHDVRKENCGSVPHD |
Parental | TWLPKKCSLCKCWHGQLRCFPQAFLPGCDGLVMDEHLVASRTPELPLSARTTTFMLVGICLSIQSYY |
TWLPKKCSLCKCWHGQLRCFPQAFLPGCDGLVMDEHLVASRTPELP.SARTTTFML.GICLSIQSYY | |
Retrocopy | TWLPKKCSLCKCWHGQLRCFPQAFLPGCDGLVMDEHLVASRTPELPPSARTTTFMLAGICLSIQSYY |
* | Stop codon |
> | Forward frameshift by one nucleotide |
< | Reverse frameshift by one nucleotide |
Library | Retrocopy expression | Parental gene expression |
---|---|---|
SRP007412_brain_prefrontal_cortex | 0 .00 RPM | 0 .43 RPM |
SRP007412_cerebellum | 0 .00 RPM | 0 .14 RPM |
SRP007412_heart | 0 .00 RPM | 0 .03 RPM |
SRP007412_kidney | 0 .00 RPM | 1 .10 RPM |
SRP007412_liver | 0 .00 RPM | 5 .70 RPM |
SRP007412_testis | 0 .00 RPM | 0 .11 RPM |
Species | RetrogeneDB ID |
---|---|
Homo sapiens | retro_hsap_4737 |
Gorilla gorilla | retro_ggor_2943 |
Species | Parental gene accession | Retrocopies number | |
---|---|---|---|
Callithrix jacchus | ENSCJAG00000002174 | 3 retrocopies | |
Felis catus | ENSFCAG00000014508 | 1 retrocopy | |
Homo sapiens | ENSG00000241186 | 7 retrocopies | |
Gorilla gorilla | ENSGGOG00000003453 | 5 retrocopies | |
Loxodonta africana | ENSLAFG00000009140 | 4 retrocopies | |
Microcebus murinus | ENSMICG00000016492 | 1 retrocopy | |
Macaca mulatta | ENSMMUG00000003088 | 6 retrocopies | |
Mustela putorius furo | ENSMPUG00000015167 | 1 retrocopy | |
Mus musculus | ENSMUSG00000032494 | 3 retrocopies | |
Nomascus leucogenys | ENSNLEG00000006143 | 6 retrocopies | |
Otolemur garnettii | ENSOGAG00000017039 | 1 retrocopy | |
Pan troglodytes | ENSPTRG00000014854 | 7 retrocopies |
retro_ptro_1333, retro_ptro_1749, retro_ptro_1831, retro_ptro_2319, retro_ptro_2685, retro_ptro_3153 , retro_ptro_3194,
|
Tarsius syrichta | ENSTSYG00000013609 | 2 retrocopies | |
Tursiops truncatus | ENSTTRG00000017299 | 1 retrocopy |